Details for Chinese cabbage Locus Brara.A02705

Position : A01 ( 5`- 22885729 .. 22891888 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02705

Protein [Map View]
MATVLHSESRRLYSWWWDSHIPKNSKWIHQNLADMDSKVKAMIKLIEEDADSFARRAEMYYKKRPELMKLVEEFYRAYRA
LAERYDHATVELRHAHKTMAEAFPNQVPFDMIEDSASSSCSEPRTPEKTPPGIQPFYDSDSAATSRRGLSHVGSSETEVE
SLKRTLIELGAEKEALSLQYQLSLNKLSRLEKDLKDAQKDVNGLDERASKAEIESRILAEGLEKLEAERDNALLRYNQSM
KKIADLEESYARAQEDVKGLTNRATEAETEAETLKQVQSRLHSEKEAGLARYNQCLVMISTLEKKVKEAEENALMLSNQS
LKAEDEIKALRQELLKVNEVKEGLSLRYQQCLETISKLEREVINAQENAKRLSSEVLAGAAKLKTVEEQCTVLESSNETL
KLEADGLTHRLAAKDQELIQKQNELEKFQVVIQDEHSRFLEIEASLRSLKSLHSQSQEEQKVLTSEIQSRVDILRELETR
NHKLEGEINSVKEENRNLSDSSMISLETQRCEISTLKEVKGKLEEEVARQINQSSALQEEIHRLKDEINSLNRRYQTIMK
QVKLAGLDPESLACSVRNLQDENSKLSELWSHQRGDKDALTEKLREMDNILRKNVGLEKLLLESNTKLDGSREKTKDLQE
RCESLRGEKSEFTAERANLFSQLQIMTENMQKLLEKNSSLEASLSGANIELQCAREKSKCFEEFFQLLKKDKAELTKERE
SLISQLNSNKEKLGVLEKNFTELQGRYADLQRDKHYKNLQVEELRVSLATEKQERASYERSTDTRLADLQSNVSFLREEC
RSRKKEFEEELDRAVDAQVEIFILQKFIEDLEQKNFSLLVECQKYAEASTFSEKLITELESENLEQQMETEFLLHEVDNC
RGAIYQVFKALQLEAADQKISRERVPVSRILGGISELKRSLSISEYEKQRLVIENSVLFSLLGEFQSDGMKVESEKQNAE
KDLETIVHRYGMLKKDMLELLEMNRQLKSELIEREKRELDLRADLQTEHLKFETLHESYTALNQEYSKALDENKTLDLTF
SEIKGEMHKLLEENDAILQEAVSLSNMSVVYKSFGFEKAEQVEAFAENFRRLQDVNRELKQKVERLEEKLRGKELGSQEL
NSKLEKLEENVEEANELNDLLEQQVSDKEAILRQKEMDLLEAQDMLKATHNAIAELCQEVEELKKDCKESRQLRGNLERR
IFELSDFSGRQDEEIKKLSSLKENLESEVELLHKEIQEHRVREEFLSSELQEKSNEFELWDAEATSFFFDLQISAVREVL
LENKVKELTGVCESLKDEAVTKTTEIKQIRETVGFLEYEVAELKNQLSVYDPVVASLADDVKSLEQNALVLMKLPTLSDR
CREDDEYPEAVVSQEPKGHSSTNQENGIVLLQDMKKRIKIIEQAVVGEKKRLGKQRRRSSLHRSKDRKLFEEIELEEFSG
EIRHQPRSPAMTEARNGSIMKDIPLDHVANSPFYGRSRRGSRGSSDQMLELWEESAEPVSTIKSLMNNKTSKKPMIPRLH
RRSRNPSIESEKAVDKLELSRNTEDNAKIMERLLSDSRRLASLRISLRDLKSKLDLNEKQGSKFTNPDVARVRKQLKETE
EAILQLANTNEILSKEIEETGDARDIYRKVVMEKSRLGSEKIEQMQQEMQSIERTVLKLEDRVAKSKGKTKFSESRTVIL
LRDIIHKGGKRTARKKKNRFCGCMRSSAKED*

DNA
ATGGCTACCGTGTTGCACTCCGAGTCCAGGCGCTTATACTCATGGTGGTGGGATAGTCACATCCCCAAAAACTCTAAATG
GATCCACCAGAATCTTGCAGATATGGATTCTAAAGTCAAGGCCATGATTAAACTCATCGAAGAAGACGCAGATTCCTTTG
CGAGAAGGGCAGAGATGTACTACAAGAAACGTCCGGAGCTTATGAAACTGGTTGAAGAGTTCTACAGAGCTTACCGTGCG
TTAGCAGAGAGGTACGATCACGCGACTGTGGAGCTTCGCCACGCTCACAAGACCATGGCCGAGGCGTTTCCTAACCAAGT
TCCGTTCGATATGATTGAAGATTCCGCTTCTTCCTCTTGTTCTGAGCCACGTACTCCTGAGAAAACTCCTCCTGGAATCC
AGCCTTTTTATGACTCGGACAGTGCCGCCACGAGTAGAAGAGGGTTAAGTCATGTTGGAAGTTCTGAAACAGAAGTTGAG
AGTTTGAAGAGAACATTGATTGAGCTTGGGGCTGAGAAGGAAGCCTTGAGTCTTCAGTATCAGCTGAGCTTGAACAAACT
ATCCAGACTAGAGAAAGACCTTAAAGATGCTCAAAAGGATGTCAATGGTCTTGATGAGCGTGCTAGCAAAGCTGAGATTG
AGAGTAGGATACTTGCAGAAGGCCTTGAAAAGCTTGAAGCCGAGAGGGATAATGCGCTTCTTCGTTATAATCAGTCCATG
AAGAAGATAGCAGATCTGGAGGAATCATATGCTCGTGCGCAAGAAGATGTGAAGGGGCTTACCAACCGAGCAACTGAAGC
AGAGACAGAAGCGGAGACTCTTAAGCAAGTGCAAAGTAGATTGCACTCCGAGAAGGAGGCTGGCTTAGCCAGATACAATC
AATGCCTTGTGATGATATCTACTCTAGAGAAGAAGGTTAAAGAGGCCGAGGAGAATGCTCTGATGCTTAGCAATCAATCT
CTAAAAGCAGAAGATGAGATTAAAGCATTGAGACAAGAACTTCTGAAAGTAAATGAAGTGAAGGAAGGTTTGAGTCTTCG
GTACCAGCAGTGTTTGGAAACTATATCCAAGCTAGAGAGAGAAGTTATTAATGCGCAAGAGAATGCTAAAAGGCTGAGTA
GCGAAGTCCTAGCTGGAGCTGCAAAGCTGAAGACTGTGGAGGAGCAGTGTACTGTTTTGGAGAGCTCAAATGAAACTTTA
AAGCTAGAAGCAGATGGTCTAACACACAGATTAGCAGCTAAGGATCAAGAACTTATCCAGAAGCAAAACGAGCTTGAGAA
GTTTCAAGTTGTAATCCAAGATGAGCACTCTCGGTTCTTGGAAATCGAAGCCAGCCTTAGAAGTTTGAAAAGTTTGCATT
CTCAGTCCCAAGAGGAGCAAAAGGTTCTCACATCTGAAATCCAAAGCAGGGTTGACATATTGAGGGAGTTAGAGACTCGT
AATCATAAGTTGGAAGGCGAGATCAACTCAGTTAAAGAAGAAAACCGAAACTTAAGCGACTCTTCTATGATCTCCCTAGA
GACTCAGAGATGCGAGATCTCCACCTTGAAAGAGGTGAAAGGAAAACTGGAGGAAGAAGTTGCTAGACAAATAAACCAAA
GCAGTGCCCTTCAAGAAGAGATCCATCGTCTCAAGGATGAAATAAACAGCTTGAACAGAAGGTATCAAACGATAATGAAG
CAAGTGAAACTCGCGGGATTGGATCCTGAATCCCTCGCCTGCTCTGTGAGGAATCTACAAGACGAGAACTCAAAGCTTTC
CGAGCTGTGGAGTCACCAGAGAGGTGATAAAGATGCTCTTACGGAGAAGCTGCGTGAAATGGATAACATTCTTAGAAAGA
ATGTTGGTCTAGAGAAACTGCTGCTGGAATCAAACACCAAGCTAGATGGTTCTAGGGAGAAGACAAAGGATCTGCAAGAA
AGATGTGAGTCTCTACGAGGAGAGAAATCTGAGTTTACTGCCGAGAGAGCTAATCTGTTTTCTCAATTGCAAATCATGAC
TGAGAATATGCAGAAGCTCTTGGAGAAGAACTCGTCGCTGGAGGCATCCCTTTCTGGTGCAAACATTGAGCTTCAGTGTG
CAAGGGAGAAGTCAAAATGCTTTGAAGAATTTTTCCAGCTGCTCAAAAAAGATAAGGCCGAGCTTACAAAGGAAAGAGAA
TCTCTCATCTCTCAGCTAAATAGTAATAAGGAGAAGCTAGGAGTTCTGGAGAAGAACTTCACAGAGTTGCAAGGAAGATA
TGCTGATCTACAGAGGGATAAACATTACAAGAATCTTCAAGTGGAAGAGCTAAGAGTCTCACTCGCCACTGAGAAGCAAG
AGCGTGCTAGCTACGAAAGGTCGACTGACACAAGATTGGCAGATCTTCAGAGCAACGTGAGCTTTCTTCGAGAAGAGTGT
CGGTCCAGGAAAAAGGAGTTTGAAGAAGAGCTTGACAGAGCAGTAGATGCACAAGTAGAGATCTTCATCTTGCAAAAGTT
TATAGAAGACTTGGAGCAGAAGAACTTTTCCCTCCTGGTTGAGTGCCAGAAATATGCAGAGGCATCAACGTTTTCAGAGA
AACTCATTACTGAGCTTGAAAGCGAGAATCTTGAGCAACAGATGGAAACGGAGTTCTTGCTGCATGAGGTTGATAACTGC
AGGGGCGCAATCTATCAAGTGTTCAAGGCACTTCAGCTTGAAGCAGCTGACCAGAAAATTTCGAGAGAGCGAGTTCCAGT
TTCACGCATCTTGGGTGGAATCAGTGAACTAAAACGCTCACTTTCCATCTCTGAATATGAGAAGCAGCGGCTTGTAATTG
AGAACTCTGTGCTCTTTTCTCTCCTTGGAGAGTTCCAATCAGATGGCATGAAGGTGGAATCAGAGAAACAAAATGCAGAG
AAAGATCTGGAGACGATAGTACACCGCTATGGAATGCTGAAGAAGGATATGCTCGAGCTATTGGAGATGAACCGGCAGTT
GAAATCAGAACTGATCGAGAGAGAGAAGCGGGAGCTGGATCTAAGAGCTGACCTACAAACTGAGCATTTAAAGTTTGAGA
CTTTGCATGAGTCATACACGGCTCTGAATCAAGAATACTCCAAAGCTCTCGACGAAAACAAAACTTTGGATCTGACATTC
TCAGAGATTAAAGGTGAAATGCATAAACTACTGGAGGAGAACGATGCAATTCTTCAGGAAGCTGTTTCCTTGAGCAACAT
GTCTGTGGTTTACAAGTCATTTGGGTTTGAAAAGGCTGAACAGGTTGAAGCATTTGCTGAAAACTTTAGAAGGTTACAAG
ATGTTAATAGGGAACTGAAGCAGAAGGTTGAGAGATTGGAAGAGAAGTTAAGAGGGAAAGAGTTGGGAAGTCAGGAGCTT
AACAGCAAGCTTGAAAAGCTAGAGGAAAACGTCGAAGAAGCCAATGAGCTAAACGATCTCTTAGAACAACAGGTTTCAGA
TAAAGAGGCAATCTTGAGACAGAAGGAGATGGACCTACTAGAAGCCCAAGACATGCTCAAGGCTACACATAACGCAATTG
CGGAACTGTGCCAAGAAGTTGAAGAGCTGAAGAAAGACTGCAAAGAATCAAGACAACTGAGGGGAAACTTAGAGAGGCGT
ATCTTTGAACTGTCTGACTTTAGTGGAAGACAAGATGAAGAGATTAAAAAGCTTAGCAGTTTGAAGGAGAATTTGGAGTC
AGAAGTTGAATTGCTACACAAGGAAATCCAAGAACACCGAGTTCGAGAGGAGTTCCTGAGTTCAGAGCTGCAGGAGAAAA
GCAATGAGTTTGAACTTTGGGATGCGGAAGCAACATCGTTCTTCTTTGATCTACAGATCTCAGCTGTCCGTGAAGTCTTG
CTTGAGAACAAAGTTAAGGAACTCACGGGAGTTTGTGAAAGCCTCAAAGATGAAGCTGTTACAAAGACCACAGAGATAAA
ACAGATAAGAGAAACAGTTGGATTTTTGGAATATGAAGTGGCTGAGCTGAAGAATCAATTGTCTGTGTATGATCCTGTGG
TAGCATCTCTAGCAGATGATGTAAAATCCCTAGAGCAAAATGCCCTGGTGCTGATGAAACTCCCTACACTATCTGACCGT
TGCAGAGAGGATGATGAGTATCCAGAAGCGGTAGTCTCTCAAGAACCAAAAGGGCATAGCAGTACCAACCAAGAAAATGG
AATTGTGCTATTGCAAGACATGAAGAAAAGAATTAAAATCATCGAGCAAGCAGTTGTTGGGGAGAAGAAGAGGCTTGGGA
AGCAGAGAAGGCGAAGCTCCTTGCACAGAAGCAAAGACCGTAAGCTCTTTGAAGAGATTGAACTTGAAGAATTCTCTGGC
GAAATCAGACACCAGCCTAGATCACCTGCAATGACCGAGGCTAGAAATGGTTCAATAATGAAAGACATTCCTCTTGATCA
TGTTGCAAACTCTCCCTTCTATGGAAGGAGCCGGAGGGGTAGTCGTGGCTCCAGTGACCAGATGCTTGAGCTATGGGAAG
AATCTGCTGAACCAGTGTCTACCATCAAGTCTCTTATGAACAATAAAACCTCGAAAAAGCCTATGATTCCGCGTCTTCAT
CGCAGAAGCAGGAATCCGTCTATTGAATCTGAGAAAGCTGTTGACAAGTTAGAGTTATCTAGAAACACTGAGGACAATGC
AAAGATCATGGAGAGGCTTTTGTCTGATTCCAGAAGATTGGCAAGCCTTAGAATCAGTCTAAGAGATCTGAAAAGCAAGC
TGGATCTGAACGAGAAACAAGGCAGCAAGTTCACTAACCCTGATGTTGCTAGAGTGAGGAAACAGCTGAAAGAAACAGAA
GAAGCCATCCTTCAGCTTGCAAACACAAACGAGATTCTTTCCAAGGAAATTGAGGAGACGGGAGACGCCAGAGATATCTA
CAGAAAGGTTGTTATGGAGAAGTCAAGACTTGGATCGGAGAAGATAGAGCAGATGCAGCAAGAAATGCAGAGCATTGAGC
GAACAGTGCTGAAGCTTGAAGACCGAGTAGCCAAAAGTAAAGGAAAGACAAAGTTCTCAGAGAGTAGGACAGTGATACTC
TTGAGAGACATTATCCACAAGGGCGGGAAAAGGACAGCGAGAAAGAAGAAAAACCGTTTCTGTGGCTGCATGAGATCTTC
GGCAAAGGAAGACTAG