Details for Chinese cabbage Locus Brara.A02701

Position : A01 ( 5`- 22840481 .. 22844013 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02701

Protein [Map View]
MAAIHLFRLHLPVKTPHSLFLSLMEKPVSEAWRSDPAVRPPDTPLEPMEFLSRSWSVSALKASKALAHLTILGDSTVKLK
EKSITGGETWENSLISENPFSFASSGTSQRVVDRVLSQSQEVSPRTSGQLSHSSGPLNGFLTDSPPISPPVMDDIQNFNS
QFRPMANTPGPITARTTQSKTVGRLIKDRKEKKKEETRAQNAQIHATVTIAGVAAAVAAIAAATAASSSSGKDEQMAKTD
MAVASAATLVAAQCVEAAEIMGAERDYVASVVSSAVSVRSAADIMTLTAGATTASRGVATLKAKATKEVWNVASVIPMDK
GINPGGFSNIDSNINGSNSSSSSSHSGEFLAEDNFLGHCSREWLARGCQLLKRTRKGDLHWKIVSVYINSLNQVMLKMKS
RHVGRTFSNKKKYVVMDVIKNIPAWPGRHLLEVGEDLTYFGLKTVLRGIVEFECRSQREYEMWTQGVTRLLAVVAERNNR
YRI*

DNA
ATGGCAGCCATCCACCTCTTTCGCTTGCATCTTCCGGTTAAAACCCCACATTCTCTCTTTCTCTCTCTGATGGAAAAACC
AGTGTCTGAAGCATGGAGATCCGACCCTGCCGTCCGACCGCCGGATACCCCATTAGAGCCTATGGAGTTTCTCTCTCGCT
CCTGGAGCGTCTCAGCTCTCAAGGCCTCTAAGGCTCTCGCTCATTTGACGATCTTAGGAGATAGCACTGTCAAACTCAAA
GAGAAATCAATCACAGGCGGAGAGACATGGGAGAACAGTCTCATCTCCGAGAACCCTTTCTCCTTCGCGTCCTCTGGAAC
TTCTCAGAGGGTCGTGGACCGTGTCTTATCTCAGTCTCAAGAAGTGTCGCCACGAACATCTGGTCAGCTTTCTCACAGCA
GCGGTCCTCTCAACGGTTTCTTAACCGACAGTCCTCCAATTTCACCGCCGGTAATGGACGACATTCAGAACTTCAACTCT
CAGTTCCGTCCAATGGCGAACACTCCGGGACCTATCACGGCGAGAACCACACAGTCTAAGACGGTGGGTCGCTTGATAAA
AGACCGTAAAGAGAAAAAGAAGGAAGAGACGCGAGCACAAAACGCCCAGATTCACGCCACGGTAACTATAGCCGGCGTGG
CAGCAGCGGTGGCTGCAATCGCGGCTGCGACGGCGGCTTCTTCTAGCTCCGGGAAAGATGAGCAGATGGCTAAAACGGAC
ATGGCCGTGGCTTCTGCTGCAACCCTTGTGGCTGCTCAGTGCGTGGAGGCTGCGGAAATAATGGGAGCTGAGAGAGACTA
CGTAGCCTCCGTTGTTAGCTCCGCCGTCAGTGTTCGTTCGGCCGCAGATATCATGACATTAACAGCCGGAGCAACTACAG
CGTCAAGAGGAGTGGCTACATTGAAGGCGAAAGCGACGAAGGAGGTGTGGAACGTTGCATCAGTTATTCCAATGGATAAA
GGAATCAATCCTGGAGGCTTCAGCAATATTGATAGTAACATTAACGGTAGCAATAGCAGCTCAAGTAGTAGCCACAGTGG
CGAGTTTTTAGCGGAAGATAATTTCTTGGGTCATTGCAGCAGAGAATGGCTTGCAAGAGGTTGCCAACTCCTCAAACGCA
CCCGCAAAGGTGATCTTCATTGGAAAATAGTTTCTGTTTACATAAACAGCCTAAATCAGGTTATGTTAAAGATGAAGAGC
AGGCATGTTGGAAGAACTTTCTCAAATAAGAAAAAATATGTTGTGATGGATGTGATCAAAAACATACCAGCTTGGCCAGG
CCGCCATTTGCTGGAAGTTGGAGAGGATCTGACATACTTTGGATTGAAGACAGTTTTGCGAGGGATTGTAGAATTTGAGT
GCCGGAGCCAAAGAGAGTATGAAATGTGGACACAAGGTGTCACACGGCTTCTTGCTGTTGTTGCCGAGAGGAATAACCGA
TATAGGATATGA