Details for Chinese cabbage Locus Brara.A02700

Position : A01 ( 5`- 22819639 .. 22820520 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02700

Protein [Map View]
MIMIDEEGLITSVFSFAIFIHHSFTCLFEFAPIYSKLLNPKTYHHRFWLMGVVFRRSHHRFISTVVVFTLLLIYFSSSAT
ASPDQDLRGGLVESTKEAGGSGLPGRIVDQKRLGGPGSAPPICRSKCGKCEPCKAVHVPIQPGLIAPLEYYPEAWRCKCG
NKISMP*

DNA
ATGATAATGATTGACGAAGAGGGTTTAATCACATCCGTTTTCTCTTTCGCTATCTTTATTCATCACTCCTTTACATGTCT
GTTTGAGTTTGCACCAATTTACTCCAAACTCCTAAACCCCAAAACCTATCATCACCGGTTCTGGCTAATGGGAGTCGTCT
TCCGTCGCTCCCACCATCGTTTCATCTCAACTGTCGTTGTCTTTACTCTCCTTTTAATTTATTTTTCCTCCTCCGCGACC
GCCTCTCCTGATCAAGATCTTAGGGGAGGGCTTGTGGAGAGTACGAAGGAGGCCGGTGGGTCGGGTTTGCCCGGTCGGAT
CGTAGATCAGAAGCGGTTAGGTGGTCCGGGCTCGGCGCCTCCGATTTGTAGATCGAAGTGCGGGAAGTGTGAGCCGTGTA
AAGCAGTTCACGTTCCGATTCAACCAGGTCTTATTGCGCCATTGGAGTATTACCCCGAAGCCTGGCGCTGCAAGTGTGGC
AACAAAATCTCCATGCCCTAA