Details for Chinese cabbage Locus Brara.A02699

Position : A01 ( 5`- 22796061 .. 22797895 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02699

Protein [Map View]
MDPSYRFIKEEFPRGLNDSPSPPSSYLYTTSMAPNDPTTTLSSPQPIEGLHESEDSRTNHVVSWSQANNSFIVWDPESFS
MTLLPIFFKHNNFSSFVRQLNTYGFRKVNPDRWEFANEGFLRGQKHLLKTIRRRKTSNNNQMQPPQSSSQLQSLDNCCIE
VGKYGLDGEMDSLRRDKQVLMMELVKVRQQQQSTKMDLTLLEDKLKKTESKQKQMMSFLARAMQNPDFLQQLIEQKEKRK
NTEEAIDKKRQRPIDQGKRHVVCVEDYDDGGGGYGRYGKDAGSSSAFFDMKQETYGDMSELDRLAMHIQGLGDQCNKEDV
VLDVGKGNEEEQHKERYQDENNEIYGEGFWEDLLNEGQNFDLQGDDEENVDVLIEQLGYLGSSRH*

DNA
ATGGATCCTTCATATAGATTCATTAAAGAGGAGTTTCCTAGAGGATTGAATGATTCTCCATCACCACCATCTTCTTATCT
CTACACAACTTCCATGGCCCCAAATGATCCAACAACAACACTGAGCTCTCCACAACCAATAGAAGGTCTCCACGAATCAG
AAGATTCAAGAACCAATCATGTCGTCTCTTGGAGCCAAGCCAATAACAGCTTCATCGTCTGGGATCCAGAATCTTTTTCC
ATGACTCTCCTTCCCATCTTCTTCAAGCATAATAACTTCTCTAGCTTTGTTCGCCAGCTCAACACATATGGTTTCAGAAA
GGTGAATCCGGATCGTTGGGAGTTTGCAAATGAAGGGTTTCTTAGAGGGCAAAAGCATCTCCTCAAGACAATAAGGAGAA
GAAAGACGAGTAACAATAATCAAATGCAACCCCCTCAATCTTCCTCTCAACTACAATCTCTAGACAATTGTTGCATAGAA
GTTGGTAAGTATGGTCTAGATGGAGAGATGGATAGCCTAAGGCGAGACAAACAAGTTCTGATGATGGAGCTGGTAAAGGT
GAGACAGCAACAACAAAGCACCAAAATGGATCTCACACTGTTAGAAGATAAGCTCAAGAAGACTGAATCAAAACAAAAAC
AAATGATGAGCTTCCTAGCCCGCGCAATGCAGAATCCAGATTTCCTCCAGCAACTCATTGAGCAGAAAGAGAAGAGAAAG
AATACAGAAGAAGCAATTGACAAGAAGAGACAAAGACCGATCGATCAAGGGAAAAGACATGTGGTTTGTGTGGAAGATTA
TGATGATGGTGGTGGTGGGTATGGAAGGTATGGAAAGGATGCTGGATCCTCCTCGGCGTTTTTTGACATGAAACAAGAAA
CATATGGAGACATGTCAGAGTTAGACAGACTTGCTATGCACATTCAGGGACTTGGAGATCAGTGCAATAAGGAAGATGTG
GTATTGGATGTTGGAAAAGGAAATGAAGAAGAACAGCATAAAGAAAGGTACCAGGATGAGAACAACGAGATTTATGGTGA
AGGTTTTTGGGAAGATTTGTTAAATGAAGGTCAAAATTTTGATCTTCAAGGAGATGATGAAGAAAATGTTGATGTGCTAA
TTGAGCAGCTTGGTTATTTGGGTTCTAGTCGACACTAA