Details for Chinese cabbage Locus Brara.A02697

Position : A01 ( 5`- 22766938 .. 22768262 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02697

Protein [Map View]
MESREAMRNTKINVLALVGLILLNSINPISSLSVTVEEDECVQEYVLYEGDTVSGNFVVVDHDVFWGPDHPGIDFTVTSP
AGNIVQTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHDLAKDEHLDPVNVKIAELRESLESVVA
EQKYLKARDTRHRHTNESTRKRVIFYTVGEYIFLAAASGLQILYIRKLFSKSVAYNRV*

DNA
ATGGAGAGCAGAGAAGCGATGAGGAACACGAAGATCAATGTCTTAGCATTGGTTGGTCTGATACTATTGAATTCAATCAA
TCCAATCTCCTCGCTCTCGGTTACGGTTGAGGAAGATGAATGCGTCCAAGAGTATGTCCTCTACGAAGGAGACACCGTCT
CTGGAAACTTCGTCGTCGTCGACCATGACGTCTTCTGGGGACCAGATCATCCCGGTATTGATTTCACGGTGACGTCTCCT
GCTGGGAACATTGTACAGACGTTGAAGGGGACATCAGGAGACAAGTTTGAGTTTAAGGCACCGAGAAGTGGGATGTACAA
GTTTTGTTTCCACAACCCTTACTCTACTCCTGAGACTGTCTCCTTCTACATTCATGTTGGTCATATCCCCAACGAGCATG
ACTTAGCCAAAGACGAACACTTGGACCCGGTGAATGTGAAGATAGCTGAGCTGCGAGAGTCTTTGGAATCTGTTGTTGCT
GAGCAGAAGTATTTGAAAGCACGTGATACCCGTCACCGTCATACTAATGAGAGCACGAGAAAGCGAGTGATATTCTACAC
TGTAGGAGAGTACATTTTCCTAGCAGCAGCAAGTGGTCTCCAGATTCTCTACATTCGCAAGCTCTTCAGCAAGTCTGTTG
CATACAACAGAGTTTGA