Details for Chinese cabbage Locus Brara.A02696

Position : A01 ( 5`- 22763701 .. 22766628 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02696

Protein [Map View]
MLSALKSEEASMQLVEREEIDEDDELFEAIDKLIAQGINAGDVKKLQDAGIHTCNGLMMHTKKNLTGIKGLSEAKVDKIC
EAAEKIVNFGYMTGSDALLKRKSVVRITTGSQALDDLLGGGIETAAITEAFGEFRSGKTQLAHTLCVTTQLPTSMKGGNG
KVAYIDTEGTFRPDRIVQIAERFGMDPGAVLDNIIYARAYTYEHQHNLLLGLAAKMSEEPFKILIVDSIIALFRVDFTGR
GELADRQQKLAQMLSRIIKIAEEFNVAVYMTNQVISDPGGGMFISDPKKPAGGHVLAHAVTIRLSFRKGKGEQRVCKVFD
APNLPEGEAIFQITPGGVADAKD*

DNA
ATGCTTTCTGCTCTCAAATCGGAAGAAGCGAGCATGCAGCTCGTCGAGCGAGAAGAGATCGACGAAGACGATGAATTATT
TGAAGCGATTGACAAACTGATCGCTCAGGGTATAAACGCAGGAGATGTGAAAAAGCTACAAGATGCTGGGATCCATACCT
GTAATGGTCTCATGATGCATACCAAAAAGAACCTCACTGGAATCAAAGGATTGTCAGAGGCCAAAGTTGACAAAATCTGT
GAAGCAGCTGAGAAAATAGTGAACTTTGGATATATGACTGGAAGTGATGCTCTTCTCAAGAGAAAATCAGTTGTGCGTAT
CACTACAGGTTCCCAAGCTCTTGATGATCTCTTGGGAGGTGGGATTGAGACTGCAGCCATCACAGAGGCGTTTGGGGAGT
TCAGGTCTGGAAAAACTCAATTAGCACATACCCTTTGTGTCACCACGCAGCTGCCTACAAGCATGAAAGGTGGGAATGGG
AAAGTGGCTTACATTGACACTGAGGGAACCTTCCGCCCTGATAGGATTGTCCAAATTGCTGAAAGATTTGGAATGGATCC
CGGAGCTGTGCTTGACAATATCATTTATGCTCGTGCTTACACCTATGAGCATCAGCACAACTTGCTTCTTGGCCTTGCTG
CAAAAATGTCCGAGGAACCATTTAAGATTCTGATTGTTGACTCAATCATTGCTTTATTCCGAGTGGATTTCACTGGAAGA
GGAGAACTCGCAGACCGCCAGCAAAAACTAGCTCAGATGCTATCAAGGATAATCAAAATCGCAGAGGAGTTCAATGTTGC
AGTCTACATGACCAACCAAGTGATATCGGATCCAGGCGGTGGAATGTTCATATCAGACCCAAAGAAGCCAGCAGGTGGGC
ATGTTCTAGCTCACGCGGTGACCATCAGGCTGAGTTTCAGGAAAGGCAAAGGAGAGCAACGTGTCTGCAAAGTCTTTGAC
GCACCAAATCTCCCTGAAGGCGAAGCTATTTTCCAGATTACACCAGGAGGCGTTGCAGATGCCAAGGACTAG