Details for Chinese cabbage Locus Brara.A02694

Position : A01 ( 5`- 22736182 .. 22737227 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02694

Protein [Map View]
MFIKVKLPSNVMIPAEAMDPNGLMIQRAVLIRLLDAFASKKATKDLGYFIALKNLEEIGEGRIRETTGEIIFPVVFSGIT
FKMFKGEIVHGVVRQVHKSGVFLRCGPCENVYLSQYKMPGYDYIVEGNPLFMNQNMSRIQIGSTVRFIVLDIQWKEAEKE
FIALASLEGNNLGPF*

DNA
ATGTTCATCAAAGTCAAACTGCCATCGAATGTCATGATACCAGCTGAAGCTATGGACCCCAACGGCCTCATGATCCAGAG
AGCTGTTCTCATTCGCTTACTCGATGCCTTTGCTTCCAAGAAAGCAACCAAAGATCTCGGCTACTTCATAGCACTCAAAA
ACTTGGAGGAAATAGGCGAGGGAAGAATCAGGGAAACCACTGGCGAGATTATCTTCCCGGTGGTTTTCAGCGGAATCACC
TTCAAGATGTTCAAAGGCGAGATCGTGCACGGTGTGGTTCGCCAGGTGCACAAGTCCGGTGTCTTCTTGAGATGTGGCCC
TTGTGAAAACGTTTACTTATCACAGTATAAGATGCCTGGTTACGACTACATTGTGGAAGGAAACCCGTTGTTCATGAACC
AGAACATGTCCCGGATTCAGATCGGTTCCACGGTTCGTTTCATTGTGCTTGATATCCAGTGGAAAGAGGCAGAGAAGGAG
TTCATCGCTTTAGCCAGCCTCGAAGGAAACAATCTTGGCCCGTTCTAA