Details for Chinese cabbage Locus Brara.A02690

Position : A01 ( 5`- 22673897 .. 22675334 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02690

Protein [Map View]
MEVGSSNSSGQQLSGRVVDTRGKHRIHAQLNRLQQEARFLEEELEQLEKMNKASASCKEFLDSVDSKPDPLLPLTIGPVN
ATWDQWFERPKEAKRCGCFIL*

DNA
ATGGAAGTGGGTAGCTCGAATTCGTCGGGTCAGCAGCTATCGGGGCGGGTCGTTGATACAAGAGGCAAACACAGGATCCA
TGCCCAACTCAATAGGCTCCAACAAGAAGCTCGCTTCTTAGAGGAAGAGCTGGAGCAGCTTGAAAAGATGAACAAAGCCT
CAGCTTCTTGCAAAGAGTTCTTAGACAGTGTTGACAGCAAACCAGATCCTCTTCTTCCCCTAACAATAGGGCCAGTGAAC
GCGACATGGGATCAATGGTTCGAACGTCCGAAAGAAGCAAAACGATGTGGATGCTTCATTCTCTAA