Details for Chinese cabbage Locus Brara.A02688

Position : A01 ( 5`- 22657678 .. 22660072 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02688

Protein [Map View]
MSHSIQFSTPSRTLHFPPTRLHPPLSSFSFRQFPLTSTFKHTSLRASSSPSPDSSSSSSLLHSPNGTPAVKSEERSSGID
VDTVTEAELKENGFRSTRRTKLICTIGPATCGFEQLEALAEGGMNVARLNMCHGTRDWHRDVIRSVRRLNEEKGFAVAIM
MDTEGSEIHMGDLGGEASAKAEDGEVWTFTVRAFDASRPERTISVSYDGFAEDVRVGDELLVDGGMVRFDVIEKIGPDVK
CLCTDPGLLLPRANLTFWRDGSLVRERNAMLPTISSKDWLDIDFGIAEGVDFIAVSFVKSAEVINHLKSYLAARPGGGDI
GVIAKIESIDSLTNLEEIILASDGAMVARGDLGAQIPLEQVPAAQQRIVKVCRELNKPVIVASQLLESMIEYPTPTRAEV
ADVSEAVRQRSDALMLSGESAMGQFPDKALTVLRSVSLRIERWWREEKRYEATPLQAISSASSDKISEEICNSASKMANN
LGVDAVFVYTKNGHMASLVSRCRPDCPIFAFTNTTSVRRRLNLQWGLIPFRLSFSEDMESNLNKTFSLLKSRGMIKSGDL
VIAVSDMLQSIQVMNVP*

DNA
ATGTCTCACTCTATCCAATTCTCAACTCCTTCACGCACTCTCCACTTCCCTCCCACTCGTCTCCACCCTCCTCTCTCTTC
CTTCTCCTTCCGCCAATTCCCTCTCACCTCCACCTTCAAGCACACCTCACTCCGAGCTTCCTCCTCTCCCTCTCCCGATT
CCTCCTCCTCCTCTTCCCTTCTTCACTCCCCCAACGGCACTCCCGCCGTCAAATCGGAGGAGAGATCCTCCGGGATAGAC
GTCGATACAGTTACCGAAGCCGAGCTTAAAGAGAACGGATTCAGAAGCACGAGGAGGACGAAGCTGATCTGCACCATCGG
ACCCGCCACGTGCGGGTTCGAGCAGCTGGAAGCGCTCGCGGAGGGAGGCATGAACGTGGCGAGGCTCAACATGTGTCACG
GGACTCGCGACTGGCACCGTGATGTTATCCGCAGCGTTAGGAGGCTTAACGAGGAGAAAGGATTCGCGGTTGCGATCATG
ATGGATACCGAAGGTAGTGAGATTCACATGGGAGATCTTGGCGGCGAGGCCTCGGCTAAAGCAGAGGATGGGGAGGTTTG
GACGTTTACCGTTAGAGCTTTTGATGCTTCTCGTCCTGAACGTACCATTAGTGTCAGCTATGATGGTTTCGCTGAAGATG
TAAGAGTTGGCGATGAGCTTCTTGTTGATGGTGGAATGGTTAGATTTGATGTGATTGAGAAGATTGGTCCTGATGTCAAG
TGTCTATGTACCGACCCTGGGTTGTTGCTTCCTCGAGCTAACTTGACTTTCTGGAGAGATGGGAGTCTTGTTCGTGAGCG
TAACGCTATGCTTCCAACCATTTCCTCCAAGGACTGGTTGGATATTGATTTTGGGATTGCTGAAGGTGTGGACTTCATTG
CTGTATCCTTTGTCAAGTCTGCTGAAGTAATTAATCATCTTAAAAGTTATCTTGCTGCTCGTCCCGGTGGAGGGGACATA
GGAGTGATTGCAAAGATCGAGAGTATCGACTCCCTGACAAACTTGGAAGAAATCATCCTAGCATCAGATGGAGCCATGGT
CGCAAGAGGTGATCTGGGAGCTCAGATACCTCTTGAGCAAGTTCCAGCGGCTCAACAGAGAATCGTCAAAGTCTGCAGAG
AGCTTAACAAACCCGTCATTGTCGCCTCACAGCTACTCGAGTCCATGATTGAGTACCCAACTCCAACCAGAGCAGAAGTA
GCCGACGTTTCCGAAGCAGTAAGGCAGAGATCAGACGCGTTGATGCTCTCTGGAGAATCAGCTATGGGTCAGTTCCCGGA
CAAGGCTCTCACGGTTCTTAGGAGTGTCAGTCTGAGAATCGAAAGATGGTGGAGGGAAGAGAAACGCTACGAGGCTACAC
CACTTCAAGCCATAAGCTCTGCTTCTTCAGACAAAATCTCTGAAGAAATCTGCAACTCTGCTTCTAAAATGGCTAACAAT
CTTGGAGTGGACGCGGTCTTCGTGTACACAAAGAACGGACACATGGCGTCTCTAGTCTCCCGGTGCCGCCCTGACTGCCC
GATCTTTGCTTTCACGAACACAACCTCGGTGAGAAGACGCTTAAACCTACAATGGGGACTGATCCCGTTCCGTCTAAGCT
TCTCAGAGGACATGGAGAGCAACTTGAACAAAACATTCTCTTTACTGAAATCAAGAGGTATGATCAAGTCGGGTGACCTG
GTGATCGCTGTCTCTGACATGCTGCAATCCATCCAGGTCATGAACGTTCCGTAG