Details for Chinese cabbage Locus Brara.A02687

Position : A01 ( 5`- 22656422 .. 22657245 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02687

Protein [Map View]
MKGFNTPRKSQGRNLFYQTPTNCSDEEIQRNIEFLKKLQEADDKTLYRRYEGMMQRYLSGYITYIQLKRGLVLLLRRHRA
LIKEFRQLLSSPVRNNSEKENPKAELKRTVAFLHKIEALGESVYKAFMDALGFSGDKEILIEQLREMLRGHESLKEEFQT
FLIDNRLLKRKRDCVNVTPSYCIGPEVEKGSSSGPVLNGKYYSGGSYHPEDSSLRMVMQR*

DNA
ATGAAAGGTTTCAATACACCACGAAAAAGTCAGGGGAGAAACTTGTTTTATCAAACTCCGACTAATTGTTCGGATGAAGA
GATTCAACGAAACATCGAGTTCTTGAAGAAACTGCAAGAGGCAGATGATAAAACACTCTACCGTCGATACGAAGGTATGA
TGCAGCGTTATCTATCTGGCTATATAACCTACATCCAACTCAAACGCGGACTGGTTCTCCTTCTCCGTAGACACAGAGCT
TTGATCAAAGAGTTTCGTCAGCTTTTATCTTCTCCTGTAAGAAACAACTCCGAGAAAGAGAACCCAAAAGCCGAATTGAA
ACGCACGGTTGCGTTCTTGCACAAGATCGAAGCGTTGGGAGAGAGTGTTTACAAGGCTTTTATGGATGCGTTAGGGTTCA
GTGGTGATAAAGAGATTCTGATTGAACAACTCAGAGAAATGTTGCGCGGTCACGAATCTCTAAAAGAGGAGTTTCAAACG
TTCTTGATCGATAACCGTTTACTCAAACGCAAACGCGATTGCGTGAATGTCACGCCATCGTATTGCATTGGACCTGAAGT
TGAAAAGGGATCTTCCTCTGGTCCGGTTTTAAACGGGAAATACTACTCTGGAGGTTCATATCATCCGGAGGACTCAAGTC
TTAGAATGGTTATGCAACGGTAA