Details for Chinese cabbage Locus Brara.A02686

Position : A01 ( 5`- 22621205 .. 22622449 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02686

Protein [Map View]
MDSLPQPQNQSSPAKVLLGKYELGRRLGSGSFAKVHLARSIETNELVAVKIIDKKKTIDSNMEPRIIREIDAMRRLRDHP
NILKIHEVMATKSTIYIVMELASGGELFSKLLRRGRLPESTARRYFQQLASALQFSHRDGVAHRDVKPQNLLLDREGNLK
VSDFGLSALPEHLQNGLLHTACGTPAYTAPEVISRRGYDGAKADAWSCGVILFVLLVGEVPFDDSNIASMYRKIQRRDYK
FPSWISKQAKSIIYQMLDPNPVTRMGIETVMKTTWFKKSLDTSQFNFGSEPVLEKSSSITAFDLISLSSGLDLSGLFESK
KKRERRFTAKVSAVEVEERAKAIGERLGYAVRKTKKEVVLGSGRTAIAVEAVELAVGVVVVEVKVVDGEEGDSRWSDLIT
ELQVIVLSWHNDVM*

DNA
ATGGACTCTCTTCCTCAGCCGCAAAACCAGTCATCTCCGGCGAAAGTCCTCCTGGGGAAATACGAACTCGGTCGCCGTCT
CGGCAGCGGAAGCTTCGCCAAAGTCCATTTGGCTCGCTCCATCGAAACGAACGAGCTCGTCGCCGTTAAAATCATTGACA
AGAAGAAGACCATCGACTCCAACATGGAGCCGAGAATAATCCGTGAGATCGACGCGATGCGCCGTCTCCGTGACCATCCC
AACATCCTCAAGATCCACGAAGTCATGGCTACCAAATCCACGATCTACATCGTCATGGAACTCGCCTCCGGCGGCGAGCT
CTTCTCCAAACTCCTCCGCCGCGGCCGTCTCCCCGAATCCACAGCGCGTCGCTACTTCCAGCAGCTCGCCTCCGCGCTTC
AGTTCTCTCACCGAGACGGCGTGGCTCACCGCGACGTGAAGCCGCAGAATCTCCTCCTTGACAGGGAAGGGAACCTCAAG
GTCTCCGACTTCGGCTTATCCGCCTTGCCGGAGCATCTCCAAAACGGATTGCTCCACACGGCGTGCGGTACGCCGGCTTA
CACGGCTCCCGAGGTTATATCGCGGCGAGGATACGACGGAGCGAAGGCTGACGCGTGGTCTTGCGGTGTGATCCTGTTCG
TTCTTCTCGTCGGAGAGGTTCCTTTCGACGATTCGAACATTGCTTCAATGTATCGGAAGATTCAAAGGAGAGATTATAAG
TTCCCGAGCTGGATCTCGAAACAAGCCAAATCGATTATCTATCAGATGCTTGATCCCAACCCTGTTACGAGGATGGGGAT
AGAGACGGTTATGAAAACCACCTGGTTCAAGAAATCTCTAGACACTTCTCAATTCAATTTCGGATCTGAACCGGTTTTGG
AGAAATCGAGTTCGATCACTGCTTTTGATCTGATCTCGCTTTCGTCGGGGCTAGATCTCTCCGGTTTGTTTGAGAGTAAG
AAGAAGAGAGAGAGGAGGTTCACGGCGAAGGTTTCCGCCGTGGAGGTGGAGGAGAGAGCGAAGGCGATTGGGGAGAGATT
AGGTTATGCAGTGAGGAAGACGAAGAAAGAAGTTGTATTAGGAAGTGGAAGAACGGCGATAGCTGTGGAGGCGGTGGAGT
TAGCTGTGGGTGTTGTGGTGGTTGAAGTGAAAGTTGTTGACGGAGAAGAAGGTGATTCACGGTGGTCCGATTTGATAACA
GAGCTTCAAGTTATAGTTCTCTCGTGGCACAATGACGTCATGTAA