Details for Chinese cabbage Locus Brara.A02683

Position : A01 ( 5`- 22568404 .. 22569779 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02683

Protein [Map View]
MAYEKVNELNLKDTELRLGLPGTEQDKEEQEVSCVRSNKRQLQSDNEEESTLPTKTQIVGWPPVRSYRKNNNSVSYVKVS
MDGAPYLRKIDLKTYKNYPELLKALENLFKFTIGEYNEREGYKGSGVVPTYEDKDGDWMLVGDVPWDMFSSSCKRLRIMK
GSDALALDSAL*

DNA
ATGGCTTACGAGAAAGTCAATGAGCTTAACCTTAAGGACACAGAGCTTCGTCTTGGATTACCCGGAACGGAGCAAGATAA
GGAAGAACAAGAGGTTTCTTGCGTTAGAAGCAACAAGCGTCAACTACAGAGCGATAACGAGGAAGAATCTACACTTCCTA
CGAAAACTCAAATCGTTGGTTGGCCTCCGGTGAGATCTTACCGTAAAAACAACAACAGTGTGAGCTATGTGAAAGTGAGT
ATGGATGGAGCTCCATACCTTAGGAAAATAGATCTCAAGACATACAAAAACTATCCAGAGCTTCTCAAGGCATTAGAGAA
CCTGTTCAAGTTCACGATCGGTGAATACAACGAAAGAGAAGGATACAAAGGATCTGGAGTTGTACCAACGTACGAGGATA
AAGATGGAGATTGGATGTTGGTTGGTGATGTTCCATGGGATATGTTCTCTTCCTCTTGTAAGAGACTCAGGATCATGAAA
GGATCTGATGCTCTTGCTTTGGACTCGGCCTTATGA