Details for Chinese cabbage Locus Brara.A02680

Position : A01 ( 5`- 22512608 .. 22515185 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02680

Protein [Map View]
MDICMDKEPDGLVVYANSDSCDPNQENVSVLPPLDSVSRDEANGNTELLLTEENVEVKEYDVKECTNEVPAAKPLEDGNM
EIAALGKEAKRALKVGRWINKKRNTVPQPFALATEKRASSTTRPFTGESHGVAAVSKIYPDGYSKVQNQATKVPRKPLQP
KNKKLSDEEDSCSVASYAKSRTIVTAAPSFRSTERAEKRKEFYIKLEEKHQAMEAEKTQSEARNKEENDAALRQLRKSLM
FKANPMPKFYHEGTRPKVELKKVTHKPPPTRAKSPKLGRRNKRGHKTRKTLIGISEEDPDDETAHNADQINRFVIEEEVN
QNSLLVTRN*

DNA
ATGGATATCTGCATGGATAAAGAGCCAGATGGTCTAGTGGTCTATGCCAATAGTGATTCTTGTGATCCAAACCAAGAAAA
TGTCTCTGTACTGCCTCCCTTAGATTCAGTATCACGCGACGAAGCCAATGGAAATACAGAGCTTCTATTAACAGAAGAGA
ACGTTGAAGTAAAAGAATATGATGTTAAAGAGTGTACTAATGAAGTTCCAGCTGCTAAGCCATTGGAAGATGGCAATATG
GAGATAGCTGCGTTGGGAAAGGAAGCTAAACGTGCGTTGAAAGTAGGTCGTTGGATTAACAAAAAAAGGAACACTGTTCC
ACAACCATTTGCTTTAGCTACTGAGAAGCGTGCTTCATCTACTACACGTCCGTTTACGGGTGAGTCTCATGGAGTAGCAG
CTGTTTCGAAAATATATCCGGATGGGTATAGTAAAGTACAAAATCAGGCCACAAAGGTACCTAGGAAACCCTTGCAGCCA
AAAAACAAGAAGCTTTCTGATGAGGAAGATTCTTGCTCTGTTGCTTCTTATGCCAAATCAAGAACCATTGTCACCGCAGC
TCCTTCGTTTCGATCCACTGAGCGTGCAGAGAAGAGGAAGGAGTTCTACATAAAACTGGAAGAGAAACACCAAGCCATGG
AGGCTGAGAAAACGCAGAGCGAAGCAAGGAACAAGGAGGAAAATGATGCAGCCTTGAGGCAACTAAGAAAGAGTTTGATG
TTCAAAGCAAACCCAATGCCCAAATTCTACCATGAAGGGACTCGTCCAAAGGTTGAACTTAAGAAAGTAACACACAAGCC
ACCTCCAACTCGAGCGAAGTCGCCAAAACTAGGGCGGAGGAACAAGAGGGGGCATAAAACGCGAAAGACTCTAATAGGGA
TCTCTGAAGAAGACCCTGATGATGAAACTGCACACAATGCTGACCAGATAAACCGGTTTGTTATAGAGGAAGAAGTGAAC
CAAAACAGTCTTTTGGTGACAAGGAACTGA