Details for Chinese cabbage Locus Brara.A02679

Position : A01 ( 5`- 22498676 .. 22500177 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02679

Protein [Map View]
MVEWERTKHTCLRLVLSGTDPIFVKGTWHPSRFDISITDGSSSWLCNATEEEVAERAAQWDQPVSEYLQLAEQYLGFQQP
NSIYSFSDALEGSKRLSWTFEKEGTKLEWRWKCKPSHENKKITVGILNFLMEANIRLSEEVVNKTRSFEKMESEAEKCLA
QGERLCSEKMEFEDATYSKFISVLNAKKAKLRALRDKEVSGKEVAEEEEESTDKGESSESGRSDNEHSEEEASKKAATTT
SRGRGRKRAARS*

DNA
ATGGTTGAATGGGAGAGAACGAAGCACACGTGTCTCAGACTCGTACTCTCCGGCACCGATCCGATATTCGTCAAAGGCAC
TTGGCATCCCTCTCGGTTCGATATCTCCATCACCGATGGCTCCTCCTCTTGGCTTTGCAACGCGACGGAGGAGGAGGTGG
CGGAGCGGGCGGCGCAGTGGGACCAGCCGGTGTCGGAGTATCTCCAGCTCGCCGAGCAGTACTTAGGGTTTCAGCAGCCT
AACTCGATCTACAGCTTCTCCGACGCTCTTGAGGGATCTAAACGGCTGTCTTGGACGTTTGAGAAGGAAGGGACTAAACT
GGAGTGGAGGTGGAAATGTAAACCATCACATGAGAACAAGAAGATCACTGTTGGGATCTTGAATTTTCTTATGGAGGCTA
ACATAAGGCTAAGTGAAGAAGTTGTGAACAAGACAAGATCTTTTGAGAAGATGGAAAGTGAAGCTGAGAAATGCCTAGCG
CAAGGTGAAAGACTCTGCAGTGAAAAAATGGAGTTTGAGGATGCAACTTATTCAAAGTTCATTTCTGTGTTAAATGCAAA
GAAGGCAAAACTCAGAGCACTAAGGGACAAAGAAGTTTCAGGGAAAGAAGTTGCAGAGGAAGAGGAAGAGTCCACGGACA
AAGGTGAAAGCTCTGAGAGTGGAAGAAGCGACAATGAGCATAGTGAAGAAGAAGCCTCAAAGAAGGCAGCAACAACAACC
AGCAGAGGCCGTGGCAGGAAGAGAGCTGCACGCAGTTGA