Details for Chinese cabbage Locus Brara.A02676

Position : A01 ( 5`- 22478333 .. 22478950 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02676

Protein [Map View]
MERSNNIEWRNNFYGRSRISPWSYGDYDNYQQDHEYLLGFSWPPRSYTCSFCKREFRSAQALGGHMNVHRRDRARLRLQQ
SSSSSSTPSPPYPNPNYSYPSMATSPPPPPPPPLTLFPTLSPPSSPGYGPCLARSLSPKSKHLPENTCETMKPSLVLEAA
EAKSLGKKDARRFLKNEEIISLDLEIGVINESEQDLDLELRLGFA*

DNA
ATGGAAAGATCAAACAACATAGAGTGGAGGAACAACTTCTATGGTCGTTCAAGAATTTCACCATGGAGCTATGGGGATTA
TGATAATTACCAACAGGATCATGAGTATCTTCTAGGGTTTTCATGGCCACCAAGATCCTATACTTGCAGCTTCTGCAAAA
GGGAATTCAGATCGGCTCAAGCACTTGGTGGCCACATGAATGTTCACAGAAGAGACAGAGCCAGACTCAGATTACAACAG
TCTTCATCATCATCTTCAACACCTTCTCCTCCTTACCCTAATCCTAATTACTCTTACCCTTCCATGGCTACCTCTCCTCC
TCCTCCTCCTCCTCCTCCTCTAACCCTATTCCCAACCCTTTCGCCTCCTTCCTCACCTGGTTATGGGCCATGTTTGGCCC
GTTCCTTGAGCCCCAAGTCTAAACATCTACCAGAAAACACTTGTGAGACTATGAAGCCATCTCTTGTTTTGGAGGCTGCG
GAAGCCAAAAGTTTGGGCAAGAAAGATGCTCGCAGGTTCTTGAAAAATGAAGAAATCATCAGCTTGGACCTCGAGATTGG
TGTGATCAACGAGTCAGAGCAAGATCTAGATCTAGAGCTCCGTTTGGGTTTTGCTTAG