Details for Chinese cabbage Locus Brara.A02672

Position : A01 ( 5`- 22434941 .. 22436360 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02672

Protein [Map View]
MEKMLCLIHAGRIVFAFAFIVSAWREYDDERAWLVFNLNGEEPAEEYIILGIVMKAKYIIGLGIMMKLYGGISFLSSTYP
GALILLIYQAILSPVLYDLYNRGYIQFRQSYQHFLQISHRKMYDQYVNETLSVDNGASVAMCHHESIDQELMSQKFCDLV
NEIERQANSNPLFTQSKFNTFFMPFIKGFGIIAALVFFITMKHKYGMLKKHKTN*

DNA
ATGGAGAAAATGTTGTGTCTTATACATGCCGGTCGAATTGTTTTCGCGTTTGCGTTTATAGTGTCTGCTTGGAGAGAGTA
TGATGATGAACGTGCTTGGTTGGTATTTAACCTTAATGGTGAAGAACCTGCTGAGGAGTACATAATTCTTGGTATAGTAA
TGAAGGCCAAGTACATAATTGGTCTTGGTATAATGATGAAGTTATACGGAGGGATATCTTTCCTCTCCAGCACTTACCCC
GGCGCACTTATCTTGCTCATATACCAAGCAATATTGAGCCCGGTTTTGTATGATCTCTACAATCGAGGTTACATACAATT
TCGACAATCGTATCAACATTTTCTACAAATCTCTCATCGCAAAATGTATGATCAGTATGTGAACGAGACGCTATCGGTAG
ATAATGGAGCGTCCGTGGCCATGTGCCACCACGAGTCCATAGATCAGGAACTTATGAGCCAGAAATTTTGCGATCTAGTT
AACGAGATTGAGAGACAGGCTAACTCGAATCCTCTGTTCACACAGAGCAAATTTAACACATTTTTCATGCCCTTCATCAA
GGGTTTTGGAATAATAGCTGCGTTGGTGTTCTTCATTACGATGAAACATAAGTATGGGATGCTCAAGAAGCACAAAACTA
ATTGA