Details for Chinese cabbage Locus Brara.A02670

Position : A01 ( 5`- 22427007 .. 22428585 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02670

Protein [Map View]
MMYQSNEDDDDLLASLCFDQSGGEDPYGFIQTDQENLFPEFGVNLLPEDEQVCNNIGDQFDAFSGNLDSNGLGPFCVSSQ
LDLGTHQVCSFRGTATHVQQGQACCPVVDINSSSSVEVVKEEFEEECSRKRGRTGPCRKPGTKACREKKRRELLNDKFMD
LSSVLEPTRTPKTDKPAILDDAIRVVNHLRGEAHELKETNQKLLEEIKSLKAEKNELREEKMVLKSDKEKMEQQMRSMAA
VPSPGFMPAAFHQNKMAVYGSYGYYPNIPMMPYLLPPSQRDTSQDQKNCSKAA*

DNA
ATGATGTATCAATCAAACGAAGACGACGACGATCTTCTCGCTTCCCTTTGCTTCGATCAAAGTGGAGGAGAAGATCCTTA
CGGGTTTATACAGACAGATCAGGAAAACCTCTTTCCTGAGTTTGGTGTGAATTTGCTTCCAGAGGACGAACAAGTATGTA
ATAACATTGGAGATCAGTTTGATGCCTTTAGTGGAAACCTTGATAGCAACGGTTTAGGACCTTTTTGTGTATCATCACAA
CTTGATTTGGGGACACATCAAGTCTGTAGCTTTAGAGGGACAGCGACTCATGTACAGCAGGGACAAGCGTGTTGCCCCGT
TGTGGATATTAATTCTTCATCATCTGTTGAAGTTGTTAAGGAAGAGTTTGAGGAAGAATGCTCTAGAAAGAGGGGACGAA
CTGGACCATGTAGGAAGCCAGGAACCAAAGCCTGTCGTGAGAAAAAAAGAAGGGAGTTGCTAAACGACAAGTTCATGGAT
TTGAGCTCGGTTTTGGAGCCTACAAGGACTCCAAAGACTGACAAACCAGCAATTCTCGACGATGCAATCAGGGTAGTGAA
TCATCTCAGAGGTGAAGCTCATGAGCTTAAAGAAACCAACCAGAAGCTTCTAGAAGAGATCAAGAGTCTCAAGGCGGAGA
AGAATGAGCTAAGGGAAGAGAAGATGGTGTTGAAGTCAGATAAAGAGAAGATGGAGCAACAGATGAGATCAATGGCGGCG
GTTCCATCTCCTGGTTTCATGCCAGCAGCTTTCCATCAGAATAAAATGGCCGTTTACGGAAGTTATGGTTACTATCCAAA
CATCCCAATGATGCCATACTTACTACCGCCTTCGCAGCGTGATACTTCTCAAGATCAGAAGAATTGCTCTAAAGCTGCTT
AA