Details for Chinese cabbage Locus Brara.A02659

Position : A01 ( 5`- 22314406 .. 22317026 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02659

Protein [Map View]
MGQQQSKGELLFEQVSYGNSEGIQSLHREGADLEWMDREGKTPLIMACMNSELYDVAETLIELGANVNAYCPARHAGTPL
HHAAKRGFENIVKLLLSHCANPLVLNDDCQTPLEVARVKGFNNVVRAIESHICLFSGWMREFYGPAILDLFDPQLLSRKV
WVVIVPTGSRNPSKPFKLELVIYASLQEAQPRAVMPLWKANLEEPKPKQSDTSVIIVENSIIPRRRRQRRKRRHQVVRQT
RLRLAPSIEGDEQQLKWFCDACKGIPQTTHPSNFLQTAPSAPPLHHAMSETPNANHHYIDEASSSTTPPPPPPPPSSGKA
STSGLNSHESVIVHEPSPSVSPLTDDDDVQTPEEGPFHYPTIDSTPVDVPSSYPLPASAEGEKKEDGISGQCSICLDAPS
DTVCTPCGHVAGCMSCLTEIKSKNYGCPVCRAKIDQIIKLYRV*

DNA
ATGGGGCAGCAGCAATCAAAAGGGGAATTGCTGTTTGAGCAAGTGAGCTACGGTAACTCTGAAGGGATTCAATCTCTTCA
TCGTGAAGGAGCAGACCTCGAGTGGATGGATAGAGAAGGGAAAACGCCTTTGATCATGGCTTGCATGAACTCTGAGCTTT
ATGATGTCGCCGAGACTTTGATCGAGTTAGGCGCTAATGTCAATGCTTATTGTCCAGCTCGCCATGCAGGGACTCCTCTG
CACCATGCTGCTAAAAGAGGTTTTGAGAATATTGTTAAGTTACTTCTTTCCCATTGTGCAAATCCACTTGTTCTCAATGA
TGATTGCCAGACACCACTTGAGGTCGCTAGAGTCAAAGGGTTCAACAATGTTGTACGTGCCATTGAGAGTCACATTTGCT
TATTCTCTGGTTGGATGCGTGAGTTTTACGGCCCTGCCATTCTTGATTTATTTGATCCTCAGCTTCTTTCAAGAAAAGTA
TGGGTAGTCATTGTACCAACTGGTTCAAGAAATCCTTCAAAGCCTTTCAAGTTGGAGCTGGTTATATATGCTAGTTTGCA
GGAAGCACAGCCACGCGCAGTGATGCCGTTGTGGAAAGCAAACTTGGAGGAACCAAAACCAAAGCAGTCTGATACTTCAG
TGATTATTGTCGAGAACTCCATAATTCCAAGACGCAGGAGGCAGAGAAGAAAACGTAGGCATCAAGTAGTTAGGCAAACA
CGTCTTAGACTCGCTCCATCCATTGAAGGTGACGAACAACAACTTAAGTGGTTTTGTGATGCATGTAAAGGAATTCCTCA
GACAACACATCCTTCAAACTTTCTCCAGACAGCACCGTCTGCGCCGCCACTTCATCATGCTATGAGTGAGACACCAAATG
CCAATCACCATTACATTGATGAAGCAAGTTCCTCCACAACACCACCACCTCCACCTCCACCTCCTTCCTCAGGGAAAGCA
AGCACCTCGGGTCTCAATAGCCATGAAAGTGTTATTGTACATGAACCTTCACCATCAGTTTCTCCATTGACAGATGATGA
TGATGTACAAACCCCAGAGGAAGGTCCATTTCATTACCCAACAATCGATTCAACACCTGTTGATGTCCCATCTTCTTATC
CTCTACCAGCTTCAGCAGAGGGTGAAAAGAAAGAAGACGGGATCTCTGGACAGTGTTCTATATGTCTCGACGCTCCATCT
GACACGGTTTGCACCCCGTGTGGACATGTCGCAGGATGCATGTCTTGCTTGACCGAGATCAAATCCAAGAACTATGGATG
TCCGGTCTGTCGCGCCAAGATCGATCAGATCATTAAACTGTACCGTGTCTGA