Details for Chinese cabbage Locus Brara.A02649

Position : A01 ( 5`- 22236595 .. 22238125 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02649

Protein [Map View]
MKGLLKGLRYIARIFEDDKEPEMQIGKPTDVKHVAHIGWEGPSATTPSWMHDYKSPTAEAKGSSNKKPRDKQRNKGRRKA
STGTNNSPAESPSRVGGSTRPSRRSTGKQREQSTGSGSESGSGLDLPQQNDQSVGQKQSRQKKSKGTTGGSSIGPAKTDR
SVRAVIPSVGGLESSTGR*

DNA
ATGAAGGGTCTATTAAAAGGATTGAGGTACATTGCTCGCATCTTCGAGGATGATAAGGAACCAGAGATGCAGATTGGAAA
ACCGACCGATGTGAAACATGTTGCTCATATAGGATGGGAAGGGCCCTCTGCTACGACCCCAAGCTGGATGCATGATTATA
AGTCTCCGACGGCTGAGGCTAAAGGAAGTTCCAACAAGAAACCCAGGGATAAGCAAAGGAACAAGGGGAGGCGTAAAGCA
TCCACAGGCACAAATAACTCACCTGCAGAGTCTCCATCAAGGGTAGGAGGTTCAACAAGGCCATCAAGACGTAGCACGGG
TAAACAGAGAGAGCAGAGCACGGGTTCAGGGTCGGAGTCAGGTTCAGGGTTAGACTTACCTCAACAGAATGATCAGTCTG
TGGGACAGAAACAGTCGAGGCAGAAGAAGTCAAAAGGAACAACAGGAGGATCGTCTATTGGGCCTGCAAAGACAGATAGA
TCCGTTCGTGCGGTTATTCCTTCTGTGGGAGGTCTTGAAAGTTCTACAGGAAGATGA