Details for Chinese cabbage Locus Brara.A02647

Position : A01 ( 5`- 22222098 .. 22228128 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02647

Protein [Map View]
MVKFSKELEAQLIPEWKEAFVNYCQLKKQVKKIKISRKPKPASLYPIPHDPDFGRSLFDPVRKLARTFSDKLFSSSEKPE
IIQVRRRKSSEDGDDVEEIYQTELVQLFSEEDEVKVFFAKLDEELNKVNQFHKSKETEFVGRGEILKKQLDILAELKQIL
SDRKKRSLSGSNSQRSFSSSARNSDFSAGSPGELSETQSETSRTDEIIDALERNGVSFINSATRHKTKGGKPKMSLRVDI
PDAVAGADGGGARSIATATSVLWEELVNNPRSGGGDFINRKKIQCAEKMIRKAFVELYKGLGLLKTYSSLNMIAFTKILK
KFDKVSGQQASSSYLKVVKRSQFTSSDKVVRLMDEVESIFTKHFANNDRKKAMKFLRPHQQKDSHMVTFFVGLFTGCFVS
LFSIYIILAHLSGIFTSGAQVSYLETVYPVFSVFALLSLHMFMYGCNLFMWKSTRINYTFIFEFAPSTALRYRDAFLMGT
TFMTSVVAAMVIHLILRAAGFSASEVDTIPGILLLIFICVLICPFDTFYRPTRFCFIRILRNIVCSPFYKVLMVDFFMAD
QLTSQIPLLRHIESTACYFMAQSFRTHEYNTCKNGRIYRELAYLISFSPYFWRAMQCIRRWWDESNTDHLVNMGKYVSAM
VAAGVRITYARESTTGWLAVVLVSSVVATLYQLYWDFVKDWGLLNPKSKNAWLRDDLVLKNKNIYYLSIALNLVLRVAWI
ETIVRFRVNPVQSHLLDFLLASLEVIRRGHWNFYRVENEHLNNVGHFRAVKTVPLPFRDMDSDD*

DNA
ATGGTGAAGTTCTCAAAGGAGTTAGAGGCACAACTCATACCAGAGTGGAAAGAGGCCTTTGTTAACTATTGTCAGCTAAA
AAAACAAGTAAAAAAAATCAAAATATCTCGTAAACCAAAACCCGCTTCTCTTTACCCCATTCCTCATGATCCTGATTTTG
GCCGATCTCTTTTCGACCCGGTTCGGAAATTGGCTAGGACCTTCTCGGACAAACTATTTTCGTCCTCGGAAAAACCAGAG
ATTATTCAGGTAAGGAGAAGAAAAAGCTCAGAAGATGGGGATGACGTTGAGGAGATTTATCAAACTGAGCTTGTTCAGTT
GTTTTCTGAAGAAGACGAGGTTAAAGTGTTCTTCGCAAAATTGGATGAAGAGTTAAACAAAGTGAATCAGTTTCACAAAT
CCAAAGAGACAGAGTTTGTGGGAAGAGGAGAGATTCTGAAGAAACAGTTGGACATTCTTGCAGAACTAAAACAGATCTTA
AGTGATCGGAAGAAGAGAAGCCTTTCTGGCTCTAATTCACAACGCTCCTTCAGTTCTTCTGCTCGAAATTCTGACTTCTC
TGCAGGGTCACCAGGAGAACTAAGTGAGACACAAAGTGAAACATCAAGAACAGACGAAATCATAGATGCATTAGAGAGGA
ATGGTGTGAGTTTCATAAACTCTGCTACGAGGCACAAGACAAAAGGAGGCAAACCCAAAATGTCTCTCCGCGTCGACATT
CCCGACGCCGTGGCCGGAGCTGACGGTGGTGGTGCAAGATCCATCGCTACGGCCACTTCGGTACTATGGGAGGAGCTTGT
TAACAATCCAAGAAGTGGCGGAGGAGATTTCATCAACCGGAAAAAGATTCAGTGCGCAGAGAAGATGATACGTAAAGCCT
TTGTTGAGCTCTACAAAGGTCTTGGCCTGTTGAAGACTTACAGTTCATTGAACATGATAGCTTTTACAAAAATATTGAAG
AAATTCGACAAGGTTTCTGGTCAGCAAGCATCATCAAGTTATCTAAAGGTCGTCAAGAGATCGCAGTTTACCAGCTCTGA
TAAGGTGGTAAGACTGATGGACGAAGTGGAGTCCATATTCACAAAGCACTTCGCAAACAATGACAGGAAAAAGGCCATGA
AGTTCTTGAGACCCCACCAGCAGAAAGATTCTCACATGGTCACTTTCTTTGTTGGATTATTTACGGGTTGCTTTGTCTCA
TTGTTTAGTATTTACATAATACTGGCTCATCTTTCTGGAATCTTCACCTCTGGTGCTCAAGTTTCATATTTAGAGACTGT
GTATCCTGTTTTCAGCGTTTTTGCGTTGCTGAGTCTACACATGTTCATGTATGGATGCAATCTGTTTATGTGGAAGAGCA
CGAGGATAAACTACACCTTTATCTTCGAGTTCGCACCAAGCACAGCGTTGCGTTACCGAGACGCGTTTCTAATGGGAACC
ACGTTTATGACATCAGTCGTGGCCGCTATGGTTATACATCTCATCCTCCGCGCCGCCGGTTTCTCGGCCAGTGAAGTCGA
CACCATTCCAGGCATCCTCCTCTTGATCTTCATTTGTGTCTTGATATGCCCTTTCGACACATTTTATCGTCCTACAAGAT
TCTGCTTCATTCGCATCTTACGGAACATCGTTTGCTCGCCTTTCTACAAGGTTTTGATGGTCGATTTTTTCATGGCTGAT
CAACTTACTAGCCAGATTCCATTGCTTAGACATATTGAGTCAACTGCGTGTTACTTCATGGCTCAAAGCTTTCGAACACA
CGAATATAATACCTGCAAAAACGGAAGAATCTACAGAGAACTTGCTTACTTGATCTCTTTCTCACCTTACTTCTGGCGTG
CCATGCAATGCATAAGGAGATGGTGGGACGAATCAAACACCGATCATTTAGTCAACATGGGGAAGTACGTTTCGGCGATG
GTTGCTGCCGGAGTCCGCATAACCTACGCAAGAGAAAGCACCACCGGGTGGTTAGCCGTGGTGCTTGTGAGCTCGGTCGT
GGCCACGCTTTACCAGTTATACTGGGACTTTGTCAAAGATTGGGGTCTTTTGAACCCTAAATCCAAAAACGCATGGCTAA
GGGACGATCTAGTTCTCAAGAACAAGAACATCTACTATCTCTCCATTGCGTTGAATTTGGTATTGCGAGTTGCTTGGATC
GAGACAATAGTAAGATTCAGGGTCAATCCTGTTCAGTCTCATTTGTTAGATTTCTTATTGGCATCACTTGAAGTCATTCG
TCGAGGCCATTGGAACTTTTACAGAGTGGAGAATGAGCATTTGAACAACGTAGGCCACTTTAGGGCAGTGAAGACCGTAC
CATTACCGTTCCGTGACATGGATTCAGACGATTAA