Details for Chinese cabbage Locus Brara.A02639

Position : A01 ( 5`- 22121480 .. 22124151 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02639

Protein [Map View]
MLHQEDPMAGRINTATPLLTDHEGGGNDRGRRSSSWVQKLIDVEESKAQIMYSLPMIFTNLFIYCIPLTSVMFASHLGQL
ELAGATLANSWATVTGFAFMTGLSGALETLCGQGFGAKSYRMLGIHLQSSCIVSLVFTILISIFWFFTEPVFGLIGQDPN
ISRQAALYMKYQAPGLLAYGFLQSIVRFCQTQSIVTPLVIFSFVPLVINIGIAYVLVYLAGLGFIGAPIATSISLWIAFL
SLGTYVICSDNFKETWTGFSLEPFSYVVINLTLSLPSAAMVCLEYWAFEILVFLAGLMPNPEITTSLVAICVNTESISYM
LTYGLSAAASTRVSNELGAGNVQGAKKATSVTVKLSLVLAFGVVLALLVGHDGWVGLFSNSPVIKEEFASLRFFLAASIT
LDSIQGVLSGVARGCGWQHVVTVINLGTFYLIGMPIAAFCGFKLKLYAKGLWIGLISGILSQSSSLLLMTIFRKWTKINA
SV*

DNA
ATGCTTCATCAAGAAGATCCCATGGCTGGTCGCATCAACACGGCCACCCCGTTGTTAACTGATCATGAAGGTGGAGGAAA
TGATAGAGGAAGGAGAAGCTCATCTTGGGTTCAAAAACTGATAGACGTAGAAGAATCAAAGGCTCAGATTATGTACTCTC
TTCCAATGATATTCACAAATCTTTTCATCTATTGCATCCCTTTAACCTCTGTGATGTTTGCTTCTCACCTCGGCCAACTC
GAGCTCGCTGGTGCAACCCTCGCCAATTCTTGGGCCACCGTCACCGGTTTTGCCTTCATGACAGGGTTAAGTGGAGCACT
TGAGACATTATGTGGTCAAGGCTTTGGTGCAAAAAGCTACAGAATGTTGGGGATTCATCTACAATCATCTTGCATAGTAT
CATTAGTCTTCACCATCCTCATCTCCATCTTCTGGTTCTTCACAGAACCGGTTTTCGGACTAATTGGACAAGATCCCAAT
ATCTCAAGACAAGCTGCACTCTATATGAAATACCAAGCTCCCGGTCTACTCGCTTACGGGTTCTTACAGAGCATTGTGAG
GTTTTGCCAAACACAATCCATCGTTACTCCACTAGTCATCTTCTCGTTTGTTCCCCTGGTGATTAATATTGGTATCGCAT
ATGTTCTGGTCTATTTAGCTGGCCTTGGATTCATTGGTGCTCCAATAGCTACATCTATATCATTGTGGATCGCTTTCCTT
TCTCTTGGAACTTATGTGATCTGTTCAGACAATTTTAAGGAAACGTGGACCGGATTTTCATTAGAACCATTCAGTTATGT
AGTCATAAACTTGACATTGAGCCTCCCTTCTGCTGCTATGGTATGTTTGGAATATTGGGCGTTCGAGATACTTGTGTTCT
TGGCAGGTTTGATGCCTAATCCAGAAATCACCACCTCTTTGGTAGCTATATGCGTCAACACGGAGTCCATTAGCTACATG
TTAACATATGGACTTAGCGCAGCTGCAAGCACGCGTGTGTCCAATGAACTTGGAGCAGGAAATGTACAAGGCGCAAAGAA
GGCGACTTCTGTAACCGTTAAGCTGTCTTTAGTCCTTGCTTTTGGTGTAGTGCTTGCTTTACTTGTAGGTCATGATGGTT
GGGTTGGGTTATTCAGCAATAGTCCTGTCATCAAAGAAGAGTTTGCATCATTGAGATTCTTTCTTGCTGCCTCTATAACT
CTTGATTCAATCCAAGGTGTTCTATCAGGAGTGGCTAGAGGATGCGGATGGCAGCATGTAGTCACGGTTATAAACTTGGG
AACATTCTACTTAATTGGAATGCCTATTGCAGCCTTTTGTGGTTTCAAGTTGAAGTTATATGCCAAGGGTTTGTGGATTG
GTTTGATAAGTGGAATACTTTCCCAATCTTCATCACTCTTGCTTATGACAATTTTCCGGAAGTGGACAAAGATAAATGCG
TCGGTCTGA