Details for Chinese cabbage Locus Brara.A02638

Position : A01 ( 5`- 22103538 .. 22107369 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02638

Protein [Map View]
AMDGYQVNPTSAIEIITGLAKTLKGINGSNWHDTFLGIWIAALLLVQRERDPIEGPIPRLDTRLCMSLCIVPLVVATLIE
EGESEFVMKKLRDDLITSLQALVVSAANKATTKAIMFLSGGDVGKSCSDVMNMKDMPINCCGNMRQLIVEACIARNILDT
SAYSWPGYANGRINQIPQSLSSEAPCWSSFVKGAQLNAAMVKHYLSELEKLYEVAVKGSDDERISAAIVLCGASLTRGWN
IQEHTVEYLTRLLSPPVPADYFGAESHLIGYACMLNVVIVGIGSVDSIQIFSLHGMVPQLACSLMPICEVFGSYTPSVSW
TLPSGEEISACSVFSNAFTLLLKRDVPTVGSQLTPEHLLMVRNLHLVTPETLNKDRFRKRLSEVARAASYEPVFVDSFPK
LKIWYRQHQRCIASTLSGLAHGTPIHPTVEALFNMVFRKVKGSQTLNPVNSSGTSSSSGAASEDSVPRPEVPAWDTLKAV
PYVVDAALTACSHGRRCPRDLATGLKDLTDFLPASLATIVSYFSDEVRRGVWKPVFMNGIDWPNPAANLSNVEEYIKKIL
ATTGVDIPSLAPAGGSSPATLPLPLAAFVSLTITYKVDKASERFLNLAGTALECLAAGCPWPCMPIVASLWTQKAKRWFD
FLVFSASRTVFLHNPDAVVQLLRNCFSATLGLNANDGDVGALLGHGGISPVAPGILYFRMYRALRDTVSVTEEIFSLLIH
SVKDIAQNRLSKENLERLKTVKDGSRYGQSSLATAMTQVKLAASLSASLVWLTGGLGVVHLLIKETIPSWFLSVDKSDQE
QEGPLELVAELRGHALAYFVVLCGAFAWGVDSRSAASKRRQGIMGSYLEFLASALDGKISVGCEIATWRAYITGLVSLMV
SCLPCWVIEIDAEVLKSLSNGLR

DNA
GCTATGGATGGATATCAAGTAAACCCCACAAGTGCTATTGAAATCATTACCGGTCTAGCTAAAACACTTAAAGGAATTAA
TGGGAGCAATTGGCATGACACCTTCTTGGGTATTTGGATAGCAGCTCTACTACTTGTTCAAAGGGAAAGGGATCCTATAG
AAGGACCTATTCCTCGACTGGACACAAGGCTGTGTATGTCATTATGTATTGTACCTCTTGTAGTCGCGACCCTTATCGAA
GAGGGAGAGTCTGAATTTGTCATGAAAAAGCTACGAGATGATCTTATTACAAGTTTGCAAGCTCTTGTTGTTTCTGCTGC
AAACAAGGCTACCACAAAGGCAATCATGTTTTTGTCTGGTGGAGATGTTGGGAAGTCATGTTCTGATGTCATGAACATGA
AGGACATGCCCATCAACTGCTGTGGAAACATGCGCCAGTTGATAGTTGAGGCTTGTATAGCAAGAAACATACTGGATACG
TCGGCCTACTCGTGGCCTGGCTATGCTAATGGCCGAATCAACCAAATACCTCAGAGTCTGTCCAGTGAAGCTCCATGCTG
GTCGTCTTTTGTGAAAGGAGCCCAACTAAATGCTGCCATGGTGAAGCATTACTTATCAGAGCTGGAGAAACTATATGAGG
TCGCAGTCAAAGGATCAGATGACGAGAGGATATCTGCTGCTATAGTGCTTTGTGGCGCATCTCTTACACGGGGTTGGAAC
ATTCAGGAACACACTGTTGAATATCTTACAAGATTACTATCCCCACCCGTTCCAGCAGATTATTTCGGAGCTGAAAGTCA
TTTAATTGGTTATGCCTGCATGCTGAATGTTGTTATTGTTGGGATAGGATCTGTTGACAGCATTCAGATTTTCTCTTTGC
ATGGCATGGTTCCGCAACTTGCTTGCTCACTAATGCCAATCTGTGAAGTGTTTGGATCTTACACCCCAAGTGTATCCTGG
ACTCTTCCCTCTGGAGAAGAAATCTCAGCATGTTCTGTTTTCTCGAATGCCTTCACTCTTCTTTTAAAGCGAGATGTGCC
CACAGTTGGATCCCAACTCACACCCGAACATCTTCTTATGGTGCGTAATTTGCATCTTGTTACCCCGGAGACCCTTAATA
AAGACCGATTCAGAAAGAGACTTTCAGAAGTGGCAAGGGCAGCATCTTACGAACCCGTGTTTGTTGACTCGTTCCCCAAG
CTGAAAATCTGGTATAGGCAGCACCAGAGATGCATAGCGTCCACATTATCAGGACTTGCACATGGAACTCCTATCCACCC
GACAGTTGAAGCACTTTTCAACATGGTTTTCAGAAAGGTTAAAGGCAGTCAGACATTAAATCCAGTTAATTCCTCCGGCA
CAAGCAGTTCATCGGGAGCTGCAAGTGAAGATAGCGTTCCAAGACCTGAGGTTCCTGCTTGGGATACCCTCAAAGCTGTT
CCATATGTTGTCGATGCTGCTTTAACAGCTTGTTCTCATGGAAGGCGTTGTCCTCGTGATTTAGCAACAGGTCTGAAAGA
TTTAACAGATTTTCTCCCGGCATCACTAGCAACGATAGTAAGTTACTTCTCGGATGAGGTGAGGAGAGGTGTTTGGAAGC
CAGTATTCATGAACGGCATTGATTGGCCAAATCCTGCTGCAAACCTATCCAACGTTGAGGAATATATAAAGAAAATTCTC
GCAACAACAGGCGTTGATATCCCTAGCCTTGCTCCAGCCGGAGGGAGTTCTCCAGCAACGCTTCCTTTACCTCTAGCCGC
TTTTGTAAGTCTAACCATTACTTACAAAGTCGACAAAGCTTCAGAGCGTTTTCTCAACCTGGCCGGCACAGCACTCGAGT
GCTTGGCTGCAGGCTGCCCTTGGCCTTGCATGCCCATTGTAGCTTCCTTATGGACCCAAAAGGCGAAACGTTGGTTTGAC
TTTCTTGTTTTCTCTGCATCTCGCACCGTCTTTCTTCACAACCCAGACGCTGTGGTTCAGCTCCTCAGAAACTGCTTCAG
TGCCACCCTCGGGTTAAATGCAAACGACGGTGATGTTGGAGCTCTTCTTGGCCATGGCGGGATCTCTCCTGTAGCACCGG
GGATTCTCTATTTCCGCATGTATCGTGCTCTCAGAGACACCGTCTCTGTAACGGAAGAGATTTTCTCTCTCCTGATACAT
TCCGTGAAGGATATAGCACAGAACAGGCTCTCAAAGGAGAATCTGGAAAGGCTGAAGACAGTGAAGGACGGATCAAGATA
CGGCCAAAGCTCACTAGCAACAGCAATGACTCAAGTCAAGCTTGCTGCTTCCCTTAGTGCCTCATTGGTATGGCTAACCG
GAGGCTTAGGTGTGGTCCACCTACTCATCAAAGAAACCATCCCGTCCTGGTTTCTATCGGTTGACAAGTCAGACCAAGAA
CAAGAAGGACCATTGGAGCTAGTGGCAGAGCTAAGAGGGCATGCTCTTGCTTACTTTGTGGTCCTATGTGGAGCATTCGC
TTGGGGCGTGGACTCGAGATCAGCTGCATCAAAACGCCGCCAAGGAATCATGGGAAGCTACTTGGAGTTCCTAGCGAGTG
CCTTGGATGGGAAAATATCAGTGGGATGCGAGATAGCAACGTGGCGGGCTTATATTACCGGTTTGGTGAGTCTAATGGTG
AGCTGTTTGCCATGTTGGGTGATAGAGATCGATGCAGAAGTGTTGAAGAGTCTGAGCAACGGACTGAGA