Details for Chinese cabbage Locus Brara.A02631

Position : A01 ( 5`- 22042925 .. 22044893 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02631

Protein [Map View]
MMEIRTPKTHKAKRVLEKRAPKLVENGKKTLILHGTKTSATLSSVLMELYRLKKGGAIKYSRRNENIRPFESGGETSLEF
FSQKTDCSIFAYGSHTKKRPDNLVLGRMYDHHVYDLIEVGIDNFKSLLSFSYDKKIAPHEGSKPFICFTGEGFENVPELK
QLKEVLTDLFRGEVVDNLNLTGLDRAYICSAISPTKVFLTHCAIKLKKSGSIVPRIELVEVGPSMDLVIRRNRLPNEGLR
KEAMKSSKDKPKKKVKNVDQDDVLGKRGRIFIPEQEVGKTPLPDKSKGVKRERREGKLKKKKNKEEGSASKKHKESE*

DNA
ATGATGGAAATACGAACTCCCAAGACCCACAAAGCGAAGCGTGTACTCGAGAAGCGAGCTCCGAAGCTGGTAGAAAATGG
GAAGAAGACATTGATACTTCATGGAACGAAGACAAGCGCTACGCTTAGCTCTGTGCTGATGGAGCTGTACCGTTTGAAGA
AGGGAGGTGCCATTAAGTACTCGAGGAGGAATGAGAATATTAGACCCTTTGAGAGTGGTGGTGAAACCTCTTTGGAGTTC
TTCTCTCAAAAAACTGATTGTAGCATTTTCGCGTATGGCTCTCACACAAAGAAACGACCTGACAATCTTGTGCTCGGAAG
AATGTACGATCACCATGTCTATGATCTCATAGAAGTTGGGATTGACAACTTTAAATCTCTCCTGTCGTTTTCCTACGACA
AGAAGATAGCACCTCATGAAGGATCAAAGCCTTTCATTTGCTTTACCGGAGAAGGTTTTGAGAATGTACCAGAGCTGAAG
CAGCTTAAAGAAGTCCTCACTGATCTCTTCCGTGGCGAGGTCGTCGATAATCTAAACCTTACTGGATTAGACCGTGCTTA
CATATGCTCAGCGATATCACCAACTAAGGTTTTCCTTACTCACTGCGCTATTAAGCTAAAAAAGTCAGGGTCCATCGTGC
CTAGAATAGAGCTTGTTGAAGTAGGTCCATCCATGGACCTGGTTATCCGCCGTAATCGTCTTCCCAACGAAGGCCTAAGG
AAAGAAGCTATGAAATCATCTAAAGATAAGCCCAAGAAGAAGGTGAAGAATGTGGATCAAGATGATGTACTAGGGAAGAG
AGGGAGGATTTTTATTCCTGAGCAAGAGGTTGGAAAAACTCCATTGCCGGATAAATCGAAGGGAGTGAAGAGAGAGCGAA
GAGAGGGTAAGCTGAAGAAGAAGAAGAATAAGGAAGAAGGGTCTGCTTCCAAAAAGCATAAAGAGTCCGAGTAA