Details for Chinese cabbage Locus Brara.A02630

Position : A01 ( 5`- 22010766 .. 22011764 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02630

Protein [Map View]
MKFSISAPKQVQPILSFKNKPSIVNVNSFLHPREKVVFVMGATGSGKSRLAIDLATRFQTEIINSDKIQVYKGLDVLTNK
VTPQECRGVPHHLLGVFDSEDGNLTATDFTLLASQEISTLSANNKLPIVAGGSNSYIEALANHSSGLLLNNYECCFIWVD
VSLPVLNSFVSKRVDRMMEAGLLDEVRQVYDPKADYSVGIRRAIGVPELHEYLRYESLVDRATQRKMLDVAVKKIKQNTE
ILACRQLQKIQRLSKKWKSCMHHVDATEVFLKHNEEEADEAWENLVARPTKRIVDKFSNRHVMKNDSVEHCLTTIGAASY
GGGSGSRAHNMI*

DNA
ATGAAATTCTCAATCTCAGCACCGAAGCAGGTACAACCAATCTTGAGCTTCAAAAACAAACCATCCATTGTCAACGTCAA
CTCTTTCCTCCATCCTCGCGAAAAAGTCGTCTTCGTAATGGGAGCCACTGGATCCGGCAAGTCTCGTCTCGCCATCGACC
TTGCAACACGGTTTCAAACAGAGATCATAAACTCCGACAAGATCCAAGTTTACAAGGGGCTCGACGTCCTTACAAATAAA
GTGACACCTCAAGAATGTCGAGGCGTGCCTCACCACTTGCTCGGGGTATTTGACTCGGAAGATGGAAACCTAACGGCCAC
CGACTTCACTCTCCTTGCGTCACAAGAGATCTCAACACTCTCAGCTAACAACAAGCTTCCTATAGTAGCCGGTGGATCAA
ACTCATACATCGAAGCACTTGCGAACCATTCGTCTGGACTATTGTTAAACAACTACGAATGTTGTTTCATTTGGGTCGAC
GTTTCCTTACCAGTTCTTAACTCTTTCGTCTCAAAACGTGTCGATCGCATGATGGAAGCAGGATTACTAGATGAAGTAAG
ACAAGTATATGATCCCAAAGCGGATTATTCTGTCGGGATACGACGAGCTATCGGAGTCCCCGAACTTCACGAGTACTTAC
GGTACGAATCTCTAGTGGACCGTGCCACACAAAGAAAGATGCTTGACGTAGCGGTTAAAAAGATCAAACAGAACACAGAG
ATATTAGCTTGTCGACAGTTACAAAAGATTCAACGCCTGAGCAAGAAGTGGAAGTCGTGTATGCACCATGTGGACGCCAC
GGAAGTGTTCTTGAAACATAATGAAGAAGAAGCAGACGAGGCTTGGGAGAATCTTGTAGCGAGACCAACAAAGAGAATCG
TCGACAAGTTTTCTAATAGACATGTGATGAAAAATGATTCTGTTGAGCATTGTTTGACCACCATTGGAGCGGCGTCATAC
GGCGGAGGAAGTGGAAGTAGGGCTCACAATATGATATGA