Details for Chinese cabbage Locus Brara.A02628

Position : A01 ( 5`- 21985973 .. 21986077 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02628

Protein [Map View]
MKISKLRCWDWCKEQRTRAYIIWRCLLFLLKWED*

DNA
ATGAAGATTTCGAAGCTCCGTTGCTGGGACTGGTGTAAGGAGCAAAGAACGCGTGCTTATATCATCTGGAGGTGTTTGCT
CTTCTTGTTAAAGTGGGAAGACTAA