Details for Chinese cabbage Locus Brara.A02624

Position : A01 ( 5`- 21929897 .. 21937458 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02624

Protein [Map View]
MVSSSSSLTIASSHSFFSNDRSLPSLNPIAPSLALPAIRSSALAVTSRSKGRRCLIRRMSVSGGDSSETAPSDMIFGPIL
EDGVLRFDCSVEHRKAAFPSVSFKNSKDREVPIPSHIVPAFTPTYSLLEEQQVVTFQFSPGTSFYGTGEVGGQLERTGKR
VFTWNTDAWGYGPGTTSLYQSHPWVLVVLPTGETLGVLADTTRKCEIDLRKEGVIRIISPPSYPIITFGPFSTPTAVLQS
LSHAVGTVFMPPKWALGYHQCRWSYMSGKRVAEIAQTFRDKKIPSDVIWMDIDYMDGFRCFTFDKERFPDPSALAKHLHN
NGFKAIWMLDPGIKQEEGFDVYDSGSKNNVWVKGADGEPFIGEVWPGPCVFPDYTNSKARSWWANLVKDFISNGVDGIWN
DMNEPAVFKVVTKTMPENNIHRGDDELGGVQYHSHYHNVYGMLMARSTYEGMGLADKNKRPFVLTRAGFIGSQRYAATWT
GDNLSTWEHLHMSISMVLQLGLSGQPLSGPDIGGFAGNATPRLFGRWMGVGAMFPFCRGHSEAGTDDHEPWSFGEECEEV
CRAALKRRYQLLPHFYTLFYIAHTTGAPVATPIFFADPKDSRLRTIENAFLLGSLLIHASTLSNQGSHELQPILPRGTWL
RFDFEDSHPDLPTLYLQGGSIIALGPPHLHVGESSLSDDVTLLVSLDENGKAVGLLFEDDGDGYGYTEGRYLITHYIAER
QSSIVTVKILKSEGEWERPKRRIHVQLLLGGGAMLDAWGMVGETIQIKMPSESEVSALISTSNERFTLHMENTKLIPEKE
VLHGQKGMELSREPVELNSGDWKLNIVPWIGGRILSMTHVPSGVQWLHSRIEMNGYEEYSGTEYRSAGCTEEYNVIERDL
EQAGEDESLILEGDVGGGLVLRRKIAIPKDNPRVVQIASSIEARSVGAGSGGFSRLVCLRVHPTFCLMHPTESFVLFTSI
DGTKHEVWPDSGEQLYEGNNLPHGEWMLVDKSLNLGLVNRFDVSQVFKCVVHWDCGTVNLELWSEDRPVSKESPLKIQHE
YEVASFP*

DNA
ATGGTATCGTCATCGTCATCACTCACTATAGCTTCTTCACATTCCTTCTTCTCTAACGATCGCTCTCTTCCCTCGCTGAA
TCCGATCGCTCCATCGCTCGCCCTTCCCGCTATCAGATCCTCTGCTCTCGCCGTCACTAGCAGAAGCAAAGGAAGACGGT
GTTTAATCAGGAGGATGAGTGTAAGTGGAGGAGATAGCTCGGAAACTGCTCCATCTGATATGATTTTTGGGCCTATTTTG
GAGGATGGAGTTTTGCGGTTTGACTGTTCTGTGGAGCATAGGAAAGCTGCGTTTCCAAGTGTTTCGTTTAAGAACAGCAA
AGACCGGGAAGTACCCATTCCAAGTCACATTGTTCCAGCGTTTACTCCTACTTATTCCCTTCTTGAGGAGCAACAAGTTG
TCACTTTTCAGTTTTCTCCTGGCACATCGTTTTATGGGACGGGAGAAGTTGGTGGCCAGTTGGAGAGGACAGGGAAACGG
GTTTTTACATGGAACACTGATGCATGGGGTTATGGCCCTGGAACCACTTCACTTTACCAGTCACATCCTTGGGTACTAGT
TGTCCTTCCAACTGGAGAAACACTTGGTGTTCTTGCTGATACCACACGAAAGTGTGAGATTGATCTAAGGAAAGAAGGAG
TCATAAGAATAATCTCCCCACCATCATATCCGATAATCACATTTGGTCCTTTCTCCACACCCACTGCTGTCTTGCAGTCC
CTGTCCCATGCCGTTGGAACTGTTTTTATGCCTCCAAAGTGGGCATTAGGCTACCATCAATGCCGTTGGAGTTATATGTC
TGGCAAGCGAGTAGCCGAGATAGCTCAAACGTTTCGGGACAAGAAAATTCCATCTGATGTGATATGGATGGACATTGATT
ACATGGATGGTTTTCGTTGTTTCACATTCGACAAGGAACGTTTCCCGGATCCTAGTGCTTTGGCAAAACATCTTCATAAT
AATGGTTTCAAAGCGATCTGGATGCTTGACCCTGGAATAAAACAGGAGGAAGGTTTTGATGTCTACGATAGTGGAAGTAA
GAATAATGTTTGGGTTAAAGGAGCAGATGGGGAGCCCTTTATTGGTGAAGTGTGGCCTGGGCCTTGCGTTTTTCCTGACT
ATACGAATTCCAAAGCTCGCTCTTGGTGGGCTAATTTGGTTAAGGATTTTATTTCAAATGGTGTTGATGGTATATGGAAT
GATATGAATGAGCCAGCAGTTTTCAAAGTCGTGACAAAGACGATGCCTGAGAACAATATTCACAGAGGAGATGATGAGCT
TGGAGGTGTTCAATACCACTCGCACTACCACAATGTCTACGGGATGCTGATGGCAAGATCAACTTATGAAGGGATGGGGC
TAGCTGATAAGAATAAGCGACCTTTTGTATTGACAAGGGCTGGATTCATAGGTAGCCAGAGATATGCTGCGACCTGGACA
GGAGATAACCTTTCAACCTGGGAGCATCTACATATGTCTATATCCATGGTACTTCAGCTGGGGCTTAGTGGTCAGCCTTT
ATCAGGACCAGATATTGGTGGCTTTGCTGGCAACGCAACTCCGCGGCTATTTGGGCGTTGGATGGGCGTTGGAGCTATGT
TTCCGTTCTGCCGTGGTCATTCTGAGGCTGGCACTGATGATCATGAGCCATGGTCTTTCGGAGAAGAGTGTGAGGAAGTC
TGTCGTGCTGCATTGAAGAGGCGCTACCAACTGTTACCACATTTTTACACCCTATTTTACATTGCCCATACAACTGGTGC
TCCAGTTGCAACTCCAATCTTTTTCGCTGATCCTAAAGATTCCCGCCTAAGGACCATTGAAAATGCCTTTCTATTGGGCT
CACTTCTAATCCATGCAAGCACTTTGTCTAATCAGGGATCTCACGAGTTGCAGCCTATATTGCCCAGAGGAACTTGGTTG
AGGTTTGATTTCGAAGATTCACATCCGGATTTGCCGACATTATATTTACAAGGTGGATCCATCATAGCACTTGGTCCTCC
ACATCTCCATGTTGGGGAATCTAGCCTGTCAGATGACGTAACCTTACTTGTGTCATTAGATGAAAATGGGAAAGCTGTAG
GACTCCTATTTGAAGATGATGGAGATGGATATGGCTACACAGAAGGCAGATATCTAATTACACACTATATTGCTGAGCGA
CAGTCTTCCATTGTTACTGTGAAGATTTTAAAATCGGAAGGAGAGTGGGAGAGGCCAAAGCGTCGTATTCATGTCCAGTT
ATTACTTGGTGGTGGTGCAATGCTTGATGCTTGGGGAATGGTTGGAGAGACTATCCAGATTAAGATGCCTTCAGAAAGTG
AAGTTTCAGCGTTAATATCTACAAGCAATGAGCGCTTTACACTTCATATGGAAAATACAAAACTGATACCTGAGAAGGAA
GTGCTACATGGACAAAAGGGAATGGAACTTTCAAGGGAACCAGTTGAGCTAAACAGTGGCGATTGGAAACTGAACATAGT
TCCTTGGATTGGTGGAAGGATACTATCTATGACACATGTTCCATCAGGAGTTCAATGGCTTCACAGCAGGATAGAGATGA
ATGGTTACGAAGAGTACAGTGGTACTGAGTACCGGTCAGCTGGATGTACTGAGGAATATAATGTTATTGAGAGGGATTTG
GAACAGGCAGGAGAAGACGAATCTCTTATCCTAGAAGGTGATGTAGGTGGTGGACTGGTTCTTCGGCGTAAAATCGCAAT
ACCTAAAGACAATCCCCGAGTTGTCCAGATTGCCTCTAGCATTGAAGCCCGTAGTGTTGGTGCTGGTTCTGGTGGATTTT
CAAGGCTGGTATGCTTAAGAGTCCATCCAACTTTCTGTCTTATGCATCCGACGGAATCGTTCGTCTTGTTCACATCGATT
GATGGTACAAAGCATGAAGTTTGGCCAGACTCTGGAGAGCAATTATATGAAGGGAACAACCTCCCACATGGTGAGTGGAT
GCTGGTGGATAAGAGCCTCAATCTAGGGCTGGTAAACAGGTTCGACGTTAGTCAGGTATTCAAATGTGTTGTTCACTGGG
ACTGTGGAACCGTTAACTTGGAGTTATGGTCTGAAGACAGACCTGTCTCCAAGGAGTCACCTCTGAAAATACAGCATGAA
TATGAAGTCGCAAGTTTCCCATAA