Details for Chinese cabbage Locus Brara.A02620

Position : A01 ( 5`- 21914676 .. 21917112 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02620

Protein [Map View]
MEKQTLKYLPLGQSDPFGNGNGNEGTIGDLLGRFCNPQESFSPGIRFPPYPGQFGSDRESNKSSLLDPDSDRVPTAKPNS
RKRKSIPVGNGKDSPASSSLTASHSKVSGEKVVSKDGKRSKQDEAGSSKNVIDKCDDSKRDNKDDAKPTKDYIHVRARRG
QATDSHSLAERARREKISERMTMLQDLVPGCNRITGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRMEFNANAAVSTE
MIQQGESLTQSLYAMACSEQRLPSGGYYSLTKNMPRFSDTHFPSSDGFVQVETQGFWENDLQSIVQMGFGDIQQQQSNNN
CSEPTLQMKLEP*

DNA
ATGGAGAAGCAAACCTTAAAGTACTTACCTTTGGGTCAGAGCGATCCCTTTGGCAATGGCAACGGCAACGAAGGAACCAT
CGGCGATCTCCTCGGCAGATTCTGCAACCCTCAAGAGTCCTTCTCCCCTGGGATCCGGTTCCCTCCTTATCCGGGTCAAT
TCGGATCCGATCGCGAGAGCAACAAGAGCTCTCTCTTGGATCCAGATTCAGATCGAGTTCCGACAGCGAAACCGAACTCC
AGGAAGAGAAAATCGATCCCTGTCGGAAACGGCAAGGACTCTCCAGCTTCGTCGTCTCTTACCGCTTCCCATTCAAAGGT
TTCAGGAGAGAAGGTTGTATCGAAAGATGGGAAGAGAAGCAAGCAGGATGAAGCTGGGAGCAGTAAGAACGTAATAGACA
AGTGTGATGATAGTAAACGAGACAATAAGGACGATGCAAAGCCGACCAAAGACTACATTCATGTTAGAGCCAGAAGGGGT
CAGGCAACCGATAGCCATAGTCTCGCTGAAAGAGCGAGGAGAGAAAAGATCAGCGAGAGGATGACAATGCTTCAGGATCT
TGTTCCTGGTTGTAACCGGATCACAGGGAAAGCTGTCATGCTTGATGAGATTATCAACTATGTTCAGTCCTTGCAGAGAC
AAGTCGAGTTCTTGTCCATGAAGCTGGCTACTGTAAATCCGAGGATGGAGTTTAATGCTAATGCTGCTGTATCCACAGAG
ATGATTCAACAGGGGGAGTCGTTAACGCAGTCTCTTTACGCAATGGCTTGCTCAGAGCAAAGACTTCCATCAGGAGGATA
CTATTCTCTTACCAAGAACATGCCTAGATTCTCAGACACTCACTTTCCCTCGAGCGACGGATTTGTCCAAGTTGAGACAC
AGGGATTCTGGGAAAATGATCTGCAAAGCATTGTTCAGATGGGTTTTGGAGATATCCAGCAACAACAGAGCAACAACAAC
TGTTCTGAGCCAACACTACAGATGAAGCTTGAGCCATGA