Details for Chinese cabbage Locus Brara.A02616

Position : A01 ( 5`- 21886067 .. 21889304 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02616

Protein [Map View]
MEAPTPHLLLLLLFAVSLLTATTADDGAAMLALAKSLSPPPSDWSTTSSTGYCKWSGVRCSSDRVSSINLEDKSLSGGLA
PEISTLSELKTITLQRNKLTGKIPSFAKLASLQEIYIDSNLFDGVEPGAFAGLTSLQILSMSDNPNLSPWSFPSELAEST
SLTTIYLDNTTISGALPDIFENFASLQNLRLSYNNITGPLPPSLAKSSIQNLWINNQLSGLSGSIEVLSGMTSLSQAWLQ
KNQFTGPIPDLSKSENLFDLQLRDNQLTGVVSTTLLPLGSLKNISLDNNKFQGPLPSFPPAVEKVTDDHNYFCTTKPGVA
CDAQVTTLLAVAGGLGYPSMLAESWQGNDACNSWAYVTCSAGKVVTLNLAKHGFQGFISPAIANLTSLKSLYLNDNNLTG
DIPKVLTSMPSLNLIDVSNNNLTGEILKFPDPVKFTYKPGNVLLGTDAGDSSSPGAGGKGGGGSGGSSGGGGGGGGGSKA
PVIIGVIVAVLVFLAILGFVVYKFVMKKKYGKFRRTTDPENAGKVLVSDAASNGNGNGHGGGANNFNALNSPSSGDNSER
FLLEGGSVTIPMEVLRQVTNNFSEANILGRGGFGVVYAGELHDGTKTAVKRMECSAMGNKGMNEFQAEIAVLTKVRHRHL
VALLGYCVNGNERLLVYEYMPQGNLGQHLFEYGELGYSPLTWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLG
DDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEMITGRKALDDSLPDERSHLVT
WFRRILINKENIPKAIDQTLEADEETLESIHRVAELAGHCTAREPQQRPDMGHAVNVLGPLVEKWKPSCQEEEESFGIDV
NNMSLPQALQRWQQNEGTSTSMFHGDFSYSQTQSSIPPKPSGFPNTFDSADGR*

DNA
ATGGAGGCTCCCACGCCTCACCTCCTCCTCCTCCTCCTCTTCGCCGTCTCTCTCCTCACCGCAACCACCGCAGACGACGG
AGCAGCAATGCTTGCTCTAGCGAAATCACTCAGTCCTCCGCCGTCAGACTGGTCAACCACCTCCTCAACCGGCTACTGCA
AGTGGTCCGGCGTGAGGTGCAGCTCGGACCGCGTCAGCTCAATCAACCTCGAGGATAAGTCTCTCTCCGGCGGCTTAGCT
CCCGAGATCTCGACTCTCTCCGAGCTCAAGACGATCACTCTGCAGCGCAACAAGCTCACCGGTAAGATCCCTTCCTTCGC
GAAGCTCGCCTCTCTTCAAGAGATCTACATCGACTCGAATCTCTTCGACGGAGTTGAGCCCGGAGCTTTCGCCGGACTCA
CCAGCCTCCAGATCTTGAGTATGAGCGATAACCCTAACCTCTCCCCTTGGAGCTTCCCTTCGGAGCTCGCGGAATCGACT
TCCCTCACCACCATCTACCTCGACAACACCACCATCTCCGGCGCATTGCCTGACATCTTCGAGAACTTCGCTTCTCTCCA
AAACCTCCGCTTATCCTACAACAACATCACAGGCCCGTTACCTCCTTCCCTGGCCAAATCTTCGATTCAGAATCTCTGGA
TCAATAACCAGTTATCCGGTTTATCCGGTTCAATCGAAGTACTCTCCGGTATGACTTCGTTATCGCAAGCGTGGCTTCAG
AAGAATCAATTCACCGGTCCGATTCCAGATCTCTCGAAGAGCGAGAACCTATTCGATCTCCAGCTCAGAGATAATCAGTT
AACCGGAGTCGTATCCACGACGCTGTTACCACTCGGGAGCCTCAAGAACATTTCGTTAGACAACAACAAGTTCCAAGGTC
CTCTTCCTTCGTTCCCGCCGGCGGTTGAGAAAGTAACTGATGATCACAACTACTTCTGCACTACCAAACCCGGAGTGGCG
TGTGATGCTCAGGTGACGACGCTTTTAGCGGTGGCCGGAGGTTTGGGGTATCCGTCGATGTTGGCTGAGTCGTGGCAAGG
GAACGATGCTTGTAACAGTTGGGCTTATGTGACATGTTCAGCTGGGAAAGTTGTCACCTTGAATCTTGCGAAACATGGAT
TCCAAGGGTTTATATCTCCGGCCATTGCGAATCTCACTTCCCTCAAGAGCCTTTACCTTAACGACAACAATTTAACCGGT
GATATACCTAAAGTGTTGACCTCTATGCCTAGCTTGAATCTAATTGATGTCTCGAACAACAACCTCACTGGTGAGATTTT
GAAGTTTCCGGATCCGGTTAAGTTTACTTACAAACCGGGTAATGTTTTGTTGGGAACTGATGCTGGAGATTCTTCTAGTC
CGGGGGCTGGTGGTAAAGGCGGTGGTGGTAGTGGTGGGTCTTCTGGTGGTGGCGGTGGTGGTGGTGGTGGTAGTAAGGCT
CCTGTGATCATTGGTGTGATCGTGGCGGTTCTTGTTTTTCTTGCTATTTTAGGATTTGTGGTTTACAAGTTTGTGATGAA
GAAGAAGTATGGGAAGTTCAGAAGGACGACGGATCCTGAGAATGCAGGGAAGGTTTTGGTTAGTGATGCTGCGTCTAATG
GTAATGGGAATGGACATGGTGGAGGAGCTAATAACTTCAATGCTTTGAACAGTCCTAGTAGTGGTGACAATAGCGAGCGT
TTCCTTCTTGAAGGGGGAAGCGTTACCATTCCGATGGAGGTTCTTCGTCAAGTTACTAATAACTTCAGCGAGGCTAACAT
ATTGGGAAGAGGCGGTTTTGGTGTTGTGTACGCTGGAGAGTTACACGATGGGACCAAGACTGCGGTCAAGAGGATGGAAT
GTTCAGCAATGGGTAATAAAGGAATGAACGAGTTTCAGGCCGAGATAGCTGTGCTCACTAAGGTCAGGCATAGACATTTG
GTTGCGCTGTTGGGTTACTGTGTGAACGGGAACGAGAGATTGCTTGTCTATGAGTACATGCCGCAGGGTAATCTTGGACA
GCATTTGTTTGAGTACGGTGAACTCGGTTACTCTCCTCTGACATGGAAACAAAGAGTGAGTATCGCTCTAGACGTGGCAC
GGGGTGTTGAATATCTCCATAGCTTGGCTCAGCAGAGCTTCATCCACAGAGATTTAAAGCCCTCTAACATCCTTCTTGGT
GATGATATGAGGGCAAAGGTTGCTGATTTTGGATTGGTTAAGAACGCACCTGATGGGAAATACTCCGTTGAGACGAGATT
AGCCGGCACATTCGGTTATCTAGCACCTGAATACGCCGCTACTGGAAGAGTAACGACGAAAGTGGATGTGTATGCATTTG
GAGTGGTTCTTATGGAAATGATAACAGGAAGAAAAGCATTAGATGATTCATTACCGGACGAGAGATCCCACCTAGTCACA
TGGTTCAGAAGAATCCTTATCAATAAAGAAAACATCCCAAAGGCGATCGACCAAACATTAGAGGCAGACGAGGAAACATT
GGAGAGCATTCACAGGGTTGCTGAGCTAGCAGGACACTGCACAGCCCGTGAGCCTCAACAAAGACCAGACATGGGCCACG
CGGTTAACGTGCTAGGTCCACTGGTAGAGAAGTGGAAACCGTCGTGCCAAGAAGAAGAAGAGAGTTTTGGGATCGATGTG
AACAACATGAGTTTACCTCAAGCTCTACAGAGATGGCAGCAAAACGAAGGAACATCGACGTCAATGTTCCATGGAGACTT
CTCTTACTCTCAGACACAGTCTAGTATTCCTCCAAAGCCTTCTGGTTTCCCTAACACGTTTGATTCTGCTGATGGTCGGT
GA