Details for Chinese cabbage Locus Brara.A02615

Position : A01 ( 5`- 21876384 .. 21878209 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02615

Protein [Map View]
MAFFALFIFTLVALSSSCSYAIGPQNNKTLLSLASRIGINYGRLGNNLPSPYQSINLVKSIKAGHVKLYDADQETLMLLS
QTNLYVTIMVPNNQIISIGAEQAAADNWVNTNVLPHYPQTRIRFVLVGNEILSYNSDQDKQIWANLVPAMRKMVNSLRAR
GIHNIKVGTPLAMDVLRSSFPPSNGTFREEVAAPVMLPLLKFLNGTNSFFFLDVYPYFPWSTDPVNNHLDFALFESNSTY
TDPQTGLVYTNLLDQMLDSVIFAMTKLGYPNVRLAISETGWPNSGDIDETGANIFNAATYNRNLIKKMTANPPLGTPARR
GSPIPTFLFSLFNENRKPGSGTERHWGILNPDGTQIYDIDLSGTRPVSSLGSLPKPNNNVPFKGNVWCVAVEGANETELG
QALDFACGRSNATCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPGNEQCKFPSVTL*

DNA
ATGGCTTTTTTTGCTCTGTTCATTTTCACTCTCGTTGCCCTTTCAAGTTCATGTAGCTACGCAATTGGTCCACAGAACAA
CAAAACATTGTTATCACTTGCAAGCAGGATTGGTATAAACTACGGAAGATTAGGTAACAATCTCCCATCTCCTTACCAAT
CAATCAACCTCGTCAAGTCTATTAAAGCAGGCCACGTTAAGCTTTACGACGCCGATCAAGAAACCCTAATGCTCCTCTCT
CAGACCAATCTCTACGTCACAATCATGGTCCCTAACAACCAAATCATTTCCATCGGTGCCGAACAAGCGGCCGCAGACAA
CTGGGTCAACACCAACGTCCTTCCTCACTACCCACAAACAAGAATCCGGTTCGTCCTTGTCGGAAACGAAATTCTCAGCT
ACAACTCCGACCAAGACAAGCAAATATGGGCGAACCTTGTCCCGGCCATGCGTAAGATGGTGAACTCTCTTAGAGCAAGA
GGCATTCACAACATCAAAGTCGGAACACCACTCGCCATGGATGTTCTCCGGTCGAGTTTTCCTCCGTCCAATGGAACATT
CCGGGAAGAAGTCGCCGCTCCGGTGATGTTACCGTTGCTGAAGTTTCTCAACGGAACAAACTCTTTCTTCTTCCTTGATG
TCTACCCTTACTTCCCTTGGTCCACTGATCCGGTTAACAACCATTTGGATTTCGCTCTATTCGAATCGAATTCAACTTAT
ACCGATCCCCAAACCGGTTTGGTTTACACCAATCTATTAGACCAGATGCTCGATTCGGTTATCTTCGCGATGACCAAGCT
CGGTTACCCCAACGTCCGTCTTGCAATCTCTGAAACCGGGTGGCCTAACTCCGGCGATATCGACGAAACCGGAGCCAACA
TTTTCAATGCCGCAACTTATAACCGGAATTTGATCAAGAAGATGACTGCTAACCCGCCACTCGGTACACCAGCTAGACGC
GGTTCACCAATACCGACGTTTTTGTTCTCATTATTCAATGAAAACCGGAAACCCGGTTCAGGAACAGAGAGGCATTGGGG
AATTTTGAATCCTGACGGTACACAGATCTACGATATTGATTTGAGTGGGACAAGACCGGTTTCTAGTCTTGGTTCGTTGC
CTAAACCAAATAACAATGTTCCGTTCAAGGGCAACGTGTGGTGTGTGGCGGTAGAAGGAGCTAACGAGACGGAGTTAGGG
CAGGCGCTTGACTTTGCTTGTGGAAGAAGCAATGCCACATGTGCAGCTTTGGCACCGGGAAGAGAGTGTTACGCACCAGT
TTCGGTTACTTGGCACGCAAGCTATGCATTTAGCTCGTACTGGGCTCAGTTCCGGAACCAAAGCTCCCAGTGCTACTTCA
ACGGCTTGGCGCGTGAGACCACGACCAACCCAGGAAATGAACAATGCAAGTTCCCTAGCGTTACCCTGTAA