Details for Chinese cabbage Locus Brara.A02613

Position : A01 ( 5`- 21868499 .. 21870606 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02613

Protein [Map View]
MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMTIQTAVLIETLTALGAE
VRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKT
GQLPDPTSTDNPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDN
LYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADI
FCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETYPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGC
ATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKP
VSYRY*

DNA
ATGGCGTTGCTTGTAGAGAAGACGTCGAGTGGCCGTGAGTACAAGGTCAAGGACATGTCTCAGGCCGACTTCGGCCGTCT
CGAGATCGAGCTCGCCGAGGTCGAAATGCCTGGTCTCGTCTCTTGCGTCACCGAGTTCGGACCATCTCAGCCGCTCAAAG
GAGCAAGAATCACCGGCTCTCTCCACATGACCATCCAAACCGCTGTCCTCATCGAAACCTTAACCGCTCTCGGCGCAGAG
GTCAGATGGTGCTCCTGCAACATCTTCTCCACCCAGGACCACGCCGCCGCCGCCATTGCCCGTGACTCCGCCGCCGTGTT
CGCGTGGAAAGGGGAGACTCTCCAGGAGTACTGGTGGTGCACGGAGAGGGCTCTCGACTGGGGTCCTGGAGGTGGTCCCG
ACCTGATCGTCGACGACGGTGGTGACGCTACGCTCCTTATCCACGAAGGTGTTAAGGCTGAGGAGATCTTCGCCAAGACC
GGTCAGCTCCCCGACCCGACTTCCACCGACAATCCTGAGTTTCAGATCGTGTTGTCGATCATCAAAGATGGTCTTCAGGT
TGATCCCAAGAAGTACCACAAGATGAAGGAGAGATTGGTTGGTGTCTCTGAGGAGACCACCACTGGTGTTAAGAGGCTTT
ACCAGATGCAGGAGACTGGTGCTCTCTTGTTCCCTGCCATTAACGTTAATGACTCCGTCACCAAGAGCAAGTTTGACAAC
TTGTATGGATGTCGCCACTCTCTCCCTGACGGTCTCATGAGAGCCACTGATGTCATGATCGCCGGAAAGGTCGCCGTTAT
CTGCGGTTACGGTGATGTCGGAAAGGGTTGTGCTGCAGCCATGAAAACCGCTGGTGCACGTGTGATCGTGACTGAGATCG
ATCCAATCTGTGCCCTTCAGGCTCTCATGGAAGGCCTTCAAGTTCTAACCCTTGAGGACGTCGTCTCTGAAGCTGACATC
TTTTGCACCACCACTGGAAACAAAGACATCATCATGGTCGACCACATGAGGAAGATGAAGAACAACGCCATCGTCTGCAA
CATTGGTCACTTTGACAATGAAATCGACATGCAAGGGCTTGAGACTTACCCTGGTGTGAAACGCATCACCATCAAGCCAC
AGACTGATAGGTGGGTGTTCCCTGACACCAAGTCTGGCATCATTGTGTTAGCTGAGGGTCGTCTGATGAACTTGGGATGT
GCCACTGGACACCCGAGTTTCGTGATGTCTTGCTCGTTCACCAACCAGGTGATTGCACAGCTTGAGCTCTGGAACGAGAA
GTCAAGTGGGAAGTATGAGAAGAAGGTATATGTTTTGCCTAAACACTTGGATGAGAAGGTCGCTGCACTTCACTTGGGCA
AGCTAGGTGCTAGACTCACCAAGCTCACCAAGGACCAATCTGACTACGTTAGCATACCCGTTGAAGGTCCCTACAAGCCT
GTTAGCTACAGGTACTGA