Details for Chinese cabbage Locus Brara.A02610

Position : A01 ( 5`- 21824480 .. 21827977 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02610

Protein [Map View]
MPNMSNYTGSVSGAFPRLLGMVPGISHGPSGGVILPGVGASLGEVCRDANTMYCKLSHPPQSLLMTAIAATTSMSNLSQV
PMAPSAAAMAAAQAIVAAQTLQAHASQIRQRLFRYSSGLGSPEKRIGNLSPQLTTEQLKQLFSFCGTVVDCTITDSKHLA
YIEYSKPEEATAALALNNMEVCGRDLNVEIAKSLPQKPSLDNSSSSSLPMMMQQAVAMQQIQFQQAILMQQAMATQQAAN
KAATMKSATEFAAARAAEDYYRRRRRSRSYSPPFRCPRSHRSRSPLRYNSRSTYEGRRRSYRDSKDISESMRYCRSDYHH
SSSSRRSRSVSPQKRKSKQMIRSCQDIDVIAHLVGDKKRHKETKSTPRDDEKTNLKRRTRSRSRSRSRSRSREGRKRTRD
TSRSSDDTEPKQRGRSRSKSLEVNNDSHEDINVAEDIKEERRGRSMSRSLETKHKSSRRNELDENKDTGSRRRSRSRSVD
GKRSHAKETQSRDKTSKRSSGRRSRSVFSEGRHRRERRPSPEYSDENKSSSRRKGHSRSREKRESSRDKISKRHKRLRSA
SLGDDNGKGDRSPSPISSE*

DNA
ATGCCGAACATGTCGAACTACACTGGTTCGGTTTCTGGTGCTTTCCCGCGGCTCTTGGGGATGGTTCCAGGGATTTCTCA
TGGTCCTTCAGGTGGTGTTATTCTACCTGGAGTTGGAGCTTCGCTTGGGGAAGTGTGCCGAGATGCTAACACTATGTACT
GCAAGTTGAGTCATCCTCCACAGAGTTTGCTCATGACTGCTATAGCTGCAACAACAAGCATGAGTAATCTTAGCCAGGTA
CCTATGGCACCTTCCGCTGCAGCTATGGCTGCTGCTCAGGCTATTGTCGCCGCACAAACCCTTCAAGCTCATGCTTCTCA
GATCAGACAAAGGCTCTTTAGGTATTCTTCTGGTTTAGGTTCCCCGGAAAAAAGAATTGGTAACCTGAGTCCACAGCTTA
CCACTGAACAGCTTAAGCAGCTTTTTAGCTTCTGTGGCACAGTAGTTGACTGTACTATTACTGATTCAAAGCATCTTGCT
TATATAGAATACTCAAAACCTGAAGAAGCAACCGCTGCTTTGGCATTAAACAATATGGAAGTCTGCGGTAGGGATTTGAA
TGTTGAGATTGCAAAATCTCTTCCTCAGAAACCATCTTTGGATAACTCTTCTTCATCCTCACTACCAATGATGATGCAAC
AGGCTGTCGCGATGCAGCAGATTCAGTTCCAGCAGGCTATACTGATGCAACAAGCCATGGCTACTCAGCAGGCGGCGAAT
AAAGCTGCTACCATGAAGTCTGCCACCGAGTTTGCAGCAGCTAGAGCTGCAGAAGATTATTACAGGCGAAGGCGGAGATC
TCGGTCTTATTCACCACCATTTCGTTGCCCGCGAAGTCATAGATCAAGATCACCGTTAAGATATAACAGTCGATCAACTT
ATGAGGGGAGAAGGCGGTCATATAGAGATTCCAAGGATATTTCTGAAAGTATGCGATACTGTAGATCAGATTATCACCAT
TCATCTAGTTCAAGGAGAAGTAGGAGTGTAAGCCCGCAAAAGAGAAAATCCAAGCAGATGATTCGGAGTTGTCAAGACAT
CGACGTGATAGCTCATCTCGTGGGGGATAAGAAGCGACATAAGGAAACTAAATCAACCCCTAGAGATGATGAGAAAACCA
ATCTTAAACGTAGAACACGTTCAAGATCTAGATCAAGGTCAAGGTCAAGATCTCGTGAAGGCCGGAAAAGAACCAGAGAC
ACATCCCGAAGTTCTGATGATACTGAACCGAAACAGAGGGGGAGGTCTAGGTCTAAATCATTGGAAGTAAACAATGACTC
TCATGAGGATATTAATGTTGCTGAAGACATTAAGGAGGAGAGGAGGGGAAGATCTATGTCTAGATCATTGGAAACTAAGC
ACAAGTCTTCTAGGAGAAATGAGCTGGACGAAAATAAAGACACAGGATCGCGTAGGAGGTCCAGGTCGAGATCAGTGGAC
GGTAAGCGTAGTCATGCCAAGGAGACACAGAGCAGGGACAAAACGTCCAAGCGTAGTAGTGGAAGAAGGTCGAGGTCAGT
GTTTTCTGAGGGTAGGCATAGGAGAGAGAGAAGGCCATCCCCTGAATACTCTGATGAAAATAAATCATCATCAAGACGTA
AGGGACACTCGAGGTCGAGAGAAAAGAGGGAGAGTTCAAGAGATAAAATATCTAAACGTCATAAAAGATTGCGGTCAGCT
TCTCTTGGAGACGACAATGGAAAAGGTGATAGGTCACCATCTCCTATTAGTTCTGAATGA