Details for Kale Locus Bo9g008820

Position : C9 ( 5`- 2268965 .. 2270039 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo9g008820

Protein [Map View]
MSRVFEGYERQYCEISANLSKKCTSAIALDGEQKKQKLSEIKSGVEDAETLIKKMDLEVRSLPPSVKSSLLVKLREYKSD
LNNFKTEVKRITSGHLNASARDELLEAGMADTVTASADQRSRLMMSTDRLGRTTDRIKDSRKTMLETEELGVSILQDLHG
QRQSLLRAHETLHGVDDNVGKSKKILTAMTRRMNRNKWTIGAIITVLVLAIIFILYFKLTR*

DNA
ATGAGTCGCGTGTTCGAAGGATACGAGAGGCAATACTGTGAGATTTCTGCAAATCTCTCCAAGAAATGTACTTCAGCTAT
TGCTCTTGATGGAGAACAAAAGAAGCAGAAGCTGTCTGAAATCAAATCCGGAGTTGAGGATGCGGAAACATTGATTAAGA
AGATGGACCTTGAGGTGAGAAGCCTTCCACCAAGTGTTAAATCCAGCCTCCTTGTGAAACTAAGAGAATACAAATCAGAC
CTGAATAACTTCAAGACTGAAGTGAAGAGAATTACTTCTGGGCACCTAAACGCATCTGCTCGAGACGAGTTGCTAGAAGC
TGGTATGGCAGACACTGTGACGGCTTCAGCTGATCAAAGATCGAGATTGATGATGTCAACAGACCGTTTAGGCAGAACCA
CAGACAGAATCAAGGACAGCCGGAAAACGATGCTGGAGACTGAGGAGCTTGGTGTTTCAATCCTTCAGGATTTGCATGGA
CAGAGACAGTCTCTTTTACGCGCACATGAGACGCTTCATGGAGTTGATGATAACGTGGGGAAGAGCAAGAAGATATTGAC
AGCAATGACGAGGAGGATGAATAGGAACAAGTGGACCATTGGGGCTATCATCACGGTCCTTGTCCTTGCTATTATCTTCA
TCTTGTATTTCAAACTCACCAGGTGA