Details for Kale Locus Bo9g008790

Position : C9 ( 5`- 2262893 .. 2264208 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo9g008790

Protein [Map View]
MTVGNYSIVNPNEALHLPASHKIYVTVTSPKGHSQHHAENVESGKFVFTAMESGDYTTCFVSPGFRPPAKFAVDFEWKSG
VEAKDWTTIAKRGQINMLEVEVRKLLDVTESIHDEMFELREREREMQELNRSTNSRMAALSLLSFVFTLSVAGLQLWHLK
SFLERKKLL*

DNA
ATGACTGTAGGAAATTACTCCATCGTCAATCCCAACGAAGCTCTCCATCTTCCTGCTTCCCACAAAATCTATGTTACTGT
GACGTCGCCTAAAGGGCACAGTCAGCATCATGCAGAAAATGTGGAGTCTGGAAAATTCGTGTTTACGGCGATGGAAAGCG
GCGATTACACAACGTGTTTTGTGTCTCCCGGTTTTAGACCTCCGGCCAAGTTCGCAGTTGATTTCGAGTGGAAAAGTGGC
GTGGAGGCTAAAGATTGGACCACCATCGCCAAGAGAGGCCAGATCAACATGCTGGAGGTGGAGGTGAGGAAACTACTAGA
CGTGACGGAATCTATACACGACGAAATGTTTGAACTCCGGGAGAGGGAACGGGAAATGCAGGAGCTAAATCGATCGACAA
ACTCGAGAATGGCGGCTCTAAGTTTACTGTCATTCGTGTTTACGCTGTCGGTCGCTGGTCTACAACTATGGCATCTCAAG
TCATTCTTGGAAAGGAAGAAGCTTCTCTAA