Details for Kale Locus Bo9g008750

Position : C9 ( 5`- 2232300 .. 2233431 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo9g008750

Protein [Map View]
MDISFFQAYPFDLPCSRAFNGDGENNAVEFSNKRMMVKVSDESKKKQRGSRVCSRGHWRVSEDSQLAELVSVHGPQNWNH
IAEKMQGRTGKSCRLRWFNQLDPRINKRVFSVEEEERLLAAHGAFGNKWAMIAKIFNGRTDNALKNHWHVLMARKLRQQS
SSYTRRFNGSAHKPNADHTSFNISPGSVDDEEVNMEKNSWKILKEGTTNMKAQYPQEEYCSPRMPMHGHYSTFSADSLAL
TLHVSIQEPSSSLSSLSLPSSSAEYTMVATKPPAFIDFLGVGHQSLNI*

DNA
ATGGATATCTCATTTTTCCAAGCATACCCTTTTGATCTCCCTTGCAGTAGAGCATTTAATGGGGATGGAGAAAACAATGC
AGTGGAGTTCTCTAATAAAAGAATGATGGTGAAGGTGAGTGATGAATCAAAGAAGAAGCAGAGAGGTTCTAGGGTTTGTA
GTAGAGGACATTGGAGAGTTTCTGAGGATTCTCAGCTCGCGGAACTTGTTTCTGTTCACGGTCCTCAAAACTGGAACCAC
ATTGCAGAGAAGATGCAAGGAAGAACAGGCAAGAGTTGCAGACTGAGGTGGTTTAACCAGTTAGACCCAAGGATCAACAA
GAGAGTTTTCAGTGTTGAAGAAGAAGAGAGGCTACTTGCAGCTCACGGAGCATTTGGTAACAAATGGGCTATGATTGCTA
AGATTTTCAATGGAAGAACAGACAATGCCTTAAAGAATCATTGGCATGTCCTCATGGCAAGAAAGTTGAGGCAGCAATCA
AGTTCTTACACCAGGAGATTCAATGGGTCTGCTCATAAACCTAATGCAGATCACACAAGCTTCAATATCTCTCCGGGTTC
TGTAGATGATGAGGAGGTGAATATGGAAAAGAACAGCTGGAAAATTCTAAAAGAGGGAACAACTAACATGAAAGCTCAGT
ATCCCCAAGAAGAGTATTGTTCTCCACGTATGCCAATGCATGGCCACTACTCAACCTTCTCTGCAGATTCCTTGGCACTG
ACACTGCATGTCTCCATCCAAGAACCATCATCATCATTGTCGTCATTATCTCTGCCATCATCATCTGCAGAATATACAAT
GGTGGCCACCAAACCTCCAGCATTTATAGATTTTCTTGGGGTGGGCCACCAAAGCCTCAACATCTAA