Details for Kale Locus Bo9g008690

Position : C9 ( 5`- 2198330 .. 2199060 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo9g008690

Protein [Map View]
MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLSRNRRTVNRAYGG
VLSGLAVKDRIVRAFLVEEQKIVKKVLKLQKAKEKTAPKS*

DNA
ATGGTTCAACGGCTTGTGTACCGGTCACGCCACTCTTACGCCACCAAATCCAACCAACACCGCATCGTCAAAACTCCTGG
TGGGAAGTTGACTTACCAGACGACGAAGAAGAGAGCTAGTGGACCTAAGTGCCCTGTCACTGGCAAGAGAATCCAAGGGA
TACCGCATCTGAGACCTGCTGAGTACAAGAGGTCGAGGTTGTCGAGGAACAGGAGGACAGTGAACCGTGCATACGGTGGT
GTTCTCTCTGGACTAGCTGTTAAAGACAGGATCGTTAGGGCATTCTTGGTGGAAGAGCAGAAGATTGTGAAGAAGGTTTT
GAAGCTTCAGAAGGCTAAGGAGAAGACTGCACCAAAGAGTTAG