Details for Kale Locus Bo8g107120

Position : C8 ( 5`- 37973233 .. 37974104 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo8g107120

Protein [Map View]
MDHRRSSIVLIILSILSPATLSMRYELLSGHTKCISEEIHANAMSVGKYSIVNPNEDHPLPDSHKITVRVTSPQGTAYHE
ADGVSTGQFSLTAVETGDYITCISAVDHKPETMMTIDFDWRSGIHTKDWSNVAKKSQVEMMEFEVKKLFDTVTSIHDEMF
YLRDREEEMQELNRATNTKMAWFSFLSLGVCLSVAGLQFWHLKTFFQKKKLI*

DNA
ATGGATCATCGTCGGAGCTCAATTGTACTAATAATCCTCTCAATCCTATCTCCAGCGACTCTCTCCATGCGCTACGAGCT
ACTCTCGGGCCACACGAAATGCATCTCCGAGGAGATTCACGCCAACGCAATGTCCGTCGGCAAGTACAGCATCGTAAACC
CTAACGAAGATCATCCTCTCCCCGATTCCCACAAGATCACCGTCAGGGTGACGTCACCGCAAGGAACGGCGTACCACGAG
GCTGACGGAGTGAGTACGGGACAGTTCTCGTTAACGGCTGTTGAAACGGGAGATTACATAACTTGCATCTCAGCCGTTGA
TCACAAACCGGAGACGATGATGACCATTGATTTTGATTGGAGGTCGGGGATTCATACCAAGGACTGGTCTAATGTGGCTA
AGAAGAGCCAAGTCGAAATGATGGAGTTTGAGGTTAAGAAGCTATTCGACACTGTTACATCCATCCATGATGAAATGTTT
TATCTCCGCGACAGGGAAGAAGAGATGCAGGAACTGAACAGAGCCACAAACACGAAGATGGCATGGTTTAGTTTTCTGTC
GCTTGGAGTTTGTTTATCAGTCGCTGGACTTCAGTTTTGGCACTTGAAGACTTTCTTCCAGAAGAAGAAGCTCATCTGA