Details for Kale Locus Bo8g106950

Position : C8 ( 5`- 37900377 .. 37900958 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo8g106950

Protein [Map View]
MSTDTEANFRALAAVFRRRIEEGGFLPVNFASADGEADEGGESTDRRGSVIQRVVVIRSPVGLEDFLNGDGSGKQGRSPA
SKSSVESMPRVVIGGDKEAGAGGGGGGCSICLEEWSDGDVAAEMPCKHEFHSKCVEEWLGRHATCPLCRYEMPVEEVEGE
KKVGVWIGLSVSTGGRRDGEDGGDSNPRDDTEA*

DNA
ATGTCTACGGATACGGAGGCGAATTTTCGTGCGTTAGCGGCTGTGTTCCGCAGGAGGATCGAAGAAGGTGGATTCTTACC
GGTGAATTTTGCTTCAGCCGACGGAGAAGCCGATGAGGGCGGAGAATCCACCGATCGTCGCGGTTCGGTGATCCAGAGAG
TGGTTGTGATCAGATCGCCTGTCGGACTCGAGGATTTTTTGAACGGCGACGGGTCAGGGAAACAGGGGAGATCTCCGGCG
TCGAAATCGTCGGTGGAGAGTATGCCACGTGTCGTGATCGGAGGAGATAAGGAGGCAGGAGCAGGAGGAGGAGGAGGAGG
GTGTTCGATTTGTCTGGAGGAGTGGTCGGATGGTGACGTGGCGGCGGAGATGCCGTGTAAGCACGAGTTTCACTCAAAGT
GTGTGGAGGAGTGGCTGGGGAGGCACGCCACGTGTCCGTTGTGTAGGTACGAGATGCCTGTTGAGGAAGTGGAGGGAGAG
AAGAAAGTTGGGGTTTGGATTGGGCTATCTGTTAGCACCGGTGGAAGAAGAGACGGAGAAGACGGTGGTGATTCGAACCC
TCGAGATGATACAGAGGCTTAG