Details for Kale Locus Bo8g106920

Position : C8 ( 5`- 37895317 .. 37896345 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo8g106920

Protein [Map View]
MGGKGWFLLKLLMFQGLFTSPPQDPGFDFFYFVLQWPGAYCDTKRACCYPTSGKPAADFGIHGLWPNYKDGSYPSNCDPD
NEFDPSEISDLVSTLQTKWPTLSCPSNEGFKFWEHEWEKHGTCSESVMDQHKYFENTLALRDRVNLLQILTGAGIEPNDE
FYKLKDIKKAIKEATGFTPVINCNKDPEKNSQLHEIFFCVDTSGTEFIECPIIPRDRCPSHLQFAKF*

DNA
ATGGGAGGAAAGGGTTGGTTTTTGCTCAAGCTTCTAATGTTTCAAGGTCTTTTCACTTCACCTCCTCAAGATCCAGGCTT
TGATTTCTTCTACTTTGTTCTTCAGTGGCCAGGAGCCTATTGTGATACAAAACGTGCTTGTTGCTATCCAACATCCGGTA
AACCTGCGGCAGATTTTGGCATCCACGGTCTGTGGCCCAATTACAAAGACGGTTCGTATCCATCAAACTGCGATCCTGAC
AATGAATTTGATCCATCTGAGATATCGGATTTGGTAAGTACTTTGCAAACGAAGTGGCCAACATTATCGTGTCCGAGCAA
CGAAGGGTTCAAGTTTTGGGAACACGAGTGGGAAAAACACGGCACGTGTTCCGAATCCGTAATGGATCAACATAAGTACT
TTGAGAATACTCTTGCACTCAGAGATAGAGTCAATCTTCTTCAAATCCTCACAGGCGCTGGAATCGAACCAAATGACGAA
TTCTATAAACTTAAAGACATTAAAAAGGCGATAAAAGAAGCAACTGGGTTTACTCCAGTAATCAACTGTAACAAAGATCC
GGAGAAAAACAGTCAGCTTCACGAGATCTTCTTTTGCGTTGATACATCAGGAACCGAGTTTATCGAATGTCCAATTATCC
CTAGAGATAGATGTCCTTCTCATCTCCAGTTTGCTAAGTTTTAA