Details for Kale Locus Bo8g090980

Position : C8 ( 5`- 30632750 .. 30636334 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo8g090980

Protein [Map View]
MELFIIFILVFVPIFIFFIIPRQSSSDTGFKSYPIVGSIPGLVKNRHRFLDWTVETLSRCPTQTAVFRRPGKQQFVMTAK
PANVEYMLKTKFDNFPKGERFIEILEDFLGRGIFNSDGEMWWKQRKTASHEFSTKSLRDFVMTNVTLEINTRLVPVLAAA
ATTGKLLNLDDLLERFTFDNICKLAFNVDSACLGDDKAAGVEFMKAFDTASKIISQRFQSAFSYSWKIKKKLNIGSERLL
RESIVTVHKFADDIVRHKIDQSNNNNKSEDLLSRFISTEELNSPEKLRDNVIGFILAGRDTTSSALSWFFWLLSKHPHVE
NKIRQELNSIRARTGEAYGFEDLKLMNYLHAAITESLRLYPPIPLDTMSCLEDSVLPDGTFVGKAWGISYNAYAMGRMES
IWGKDCDRFDPERWIDETNGGFRGESPYKFPVFHAGPRMCLGKEMAYIQMKSIVAAVLDRFVVEVPGKDERPEILLSVTI
RIKGGLFVRVHERS*

DNA
ATGGAGCTTTTCATCATCTTCATCCTCGTCTTTGTCCCTATCTTCATCTTCTTCATCATCCCAAGACAATCTTCTTCAGA
CACAGGTTTCAAGTCGTACCCTATCGTCGGAAGCATACCTGGACTAGTGAAAAACCGTCACCGTTTCCTCGACTGGACTG
TAGAGACTCTGTCCCGATGCCCGACTCAGACGGCGGTTTTCCGGCGACCAGGGAAGCAACAGTTCGTCATGACGGCGAAG
CCTGCCAACGTGGAGTACATGCTCAAGACTAAGTTCGATAATTTCCCTAAAGGCGAGCGGTTCATCGAGATTCTTGAGGA
TTTTCTCGGCCGCGGGATTTTCAATTCCGATGGCGAGATGTGGTGGAAACAGAGGAAGACGGCGAGCCACGAGTTCAGTA
CTAAGTCTCTCCGTGACTTTGTCATGACAAACGTCACCCTCGAAATAAACACCAGGCTTGTTCCGGTGTTAGCAGCTGCA
GCGACCACCGGAAAATTGTTAAACCTTGACGACTTATTGGAGAGATTCACATTCGATAACATATGCAAGTTAGCATTCAA
CGTCGACTCCGCTTGCCTCGGAGACGACAAAGCCGCCGGTGTAGAGTTCATGAAGGCCTTTGATACGGCGTCCAAGATCA
TCTCGCAACGGTTTCAGTCAGCGTTTTCGTATTCATGGAAGATCAAAAAGAAACTAAACATTGGCTCAGAGAGACTGCTC
AGAGAATCAATCGTGACCGTCCATAAATTCGCAGACGATATCGTGCGTCACAAGATTGATCAAAGTAACAACAACAACAA
GAGCGAGGATTTGCTTTCAAGATTCATCAGCACCGAGGAGCTGAACTCTCCGGAGAAACTACGTGACAATGTCATTGGTT
TCATCCTCGCGGGACGAGACACAACCTCCTCCGCTTTGAGCTGGTTCTTCTGGTTACTCTCTAAGCATCCACATGTAGAG
AACAAGATCAGACAAGAGCTGAACTCGATCCGAGCAAGAACAGGGGAAGCTTACGGGTTTGAAGATCTTAAACTGATGAA
CTACCTGCACGCAGCGATAACCGAGTCTCTAAGGTTGTATCCGCCTATACCGTTGGACACAATGAGTTGTCTTGAGGACA
GTGTATTGCCTGATGGAACGTTTGTAGGGAAAGCTTGGGGAATAAGTTATAACGCGTACGCGATGGGGAGGATGGAGAGT
ATCTGGGGGAAAGATTGTGATCGGTTTGATCCAGAGAGGTGGATTGATGAAACAAATGGTGGGTTTAGAGGTGAGAGTCC
TTACAAGTTTCCAGTGTTTCATGCAGGACCAAGGATGTGTTTAGGTAAAGAGATGGCTTATATTCAGATGAAATCTATAG
TTGCTGCGGTGCTGGATAGGTTTGTTGTCGAGGTCCCAGGGAAGGATGAGCGTCCTGAGATTTTATTGTCTGTGACGATT
AGAATCAAAGGTGGTTTGTTTGTCAGGGTACACGAAAGAAGCTAA