Details for Kale Locus Bo8g090920

Position : C8 ( 5`- 30588138 .. 30590481 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo8g090920

Protein [Map View]
MSGRNTHWCHRCQRGVYLRGPDSLCTYCGGGFVEEIDVSPFRAHRDLERGPTYDLMEAFSAFMRSRLAERSHDRELTGRI
TASSGGGGGGSESFSSIAPFLIFGGQANNTSVEALLNTSPGGIGITRGGNVNAGDYFYGPGLEELIEQLSSGTTHHRGPP
PAAKSSIDALPTVKITQKHLKSSDSHCPVCKEEFELKSEVKQMPCKHMYHSECIVPWLVQHNTCPVCRKELPSRGSSSST
ERDQNRGSNRRRNLFSSLWPFRSSSSSSTQNRRDTSNTATAEEGGQYSHHHQLQHQQQHEQQKRQKPKTRPLRKAWKARP
LVTGVTKREDGGIGYAPLAINSLSLSLSLSLSLSKALFDERRFDVSFGDSSRRRLLRCLSSAASSPVTLLGDLFLCGPPR
RVGALSSLLVISLRGTSPPSFPSVVQIEAFTSDRKLTDRRIKVHRAKVQTIEEFTA*

DNA
ATGTCTGGTCGAAACACTCATTGGTGCCACAGATGTCAACGTGGCGTCTACCTTCGCGGTCCAGATTCTCTCTGCACCTA
TTGCGGAGGAGGCTTTGTCGAAGAAATCGATGTATCTCCCTTTAGAGCTCACAGGGATCTCGAACGTGGTCCAACGTACG
ATCTCATGGAAGCTTTCTCAGCTTTCATGAGAAGCCGCTTAGCCGAAAGAAGCCACGACAGAGAACTCACGGGAAGAATC
ACCGCCTCTTCTGGTGGTGGTGGTGGTGGTTCCGAGAGCTTCTCAAGCATAGCTCCTTTCTTGATCTTCGGCGGCCAAGC
TAACAACACTTCGGTCGAAGCCTTGCTAAACACCTCGCCTGGTGGTATCGGTATCACTCGTGGCGGCAACGTTAATGCTG
GCGACTACTTTTACGGACCAGGTCTTGAAGAATTGATCGAGCAGCTCTCGTCTGGGACGACTCACCATCGAGGTCCTCCG
CCTGCAGCTAAATCATCTATTGATGCGTTACCAACGGTTAAGATCACGCAGAAGCATCTCAAGTCGTCGGACTCTCATTG
TCCGGTTTGTAAAGAGGAGTTTGAGTTGAAGTCGGAAGTGAAACAGATGCCGTGTAAACATATGTATCATTCTGAGTGCA
TTGTTCCGTGGCTGGTTCAGCATAACACGTGTCCGGTGTGTCGTAAAGAGTTGCCGTCGAGAGGGTCGTCTTCAAGCACA
GAGAGGGATCAGAATAGAGGGAGCAACAGAAGGAGGAACCTTTTCTCTAGTCTGTGGCCGTTCAGGTCGTCTAGCTCAAG
CTCGACGCAGAACCGCAGAGATACAAGCAACACAGCCACTGCAGAAGAAGGAGGGCAGTATAGTCATCATCACCAGCTAC
AACATCAGCAACAACATGAACAACAGAAAAGACAGAAGCCCAAGACTCGCCCCTTGCGCAAGGCCTGGAAGGCCCGCCCC
TTAGTGACAGGTGTCACGAAACGAGAGGATGGAGGAATCGGTTACGCGCCTCTCGCGATCAACTCTCTCTCTCTATCTCT
CTCTCTCTCTCTCTCTCTCTCGAAAGCTCTGTTCGACGAAAGGCGATTCGACGTCTCCTTCGGTGACTCTTCTCGGCGGC
GTCTCCTTCGGTGTCTCTCATCGGCAGCGTCGTCTCCGGTGACTCTTCTCGGCGACCTCTTTCTCTGTGGTCCTCCTCGA
CGCGTCGGAGCTCTCTCTAGTTTGTTGGTTATCTCTCTCCGTGGGACTTCTCCTCCAAGCTTTCCCTCGGTGGTTCAAAT
CGAAGCTTTCACCTCAGATCGAAAGTTGACAGACAGAAGGATCAAAGTTCATAGAGCAAAGGTTCAAACAATTGAGGAGT
TCACGGCATAA