Details for Kale Locus Bo8g090910

Position : C8 ( 5`- 30584583 .. 30586749 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo8g090910

Protein [Map View]
MASRRLIAFKKWMKANGVDCSDALDLVEDQNDAVSVKASRDLKEGDVVANISKTACLTVKTSGAREMIESAELDGPLALS
VAIMYERGLGQESPWAGYLQILPFQEDLPLVWPLDELDSLLSGTEIHKDVKKDHGLVYEDWEENIVPLTPLLPENVDPGS
FGIKEYLAAKSLIASRSFEIDDYHGWGMVPLADLFNHKTGEEDVHFTAELPHSESDSEADETDNSDAASAATDEEDETSS
KNSTSPEQSLEDENTDEEAKEEEDSSMLQDDVSSLEMIMVKNVPAGAEVYNTYGLIGNAALLHRYGFTELDNLYNIVNID
LDLVTEWSTSSFTTRYTRARLALFKKLGYNSEYFEVSSTGEPETELLMLLNILLLPEDTYNKLDLALTGDCVSKEGREIT
IGKHKVKFGESCSSDVLLTDGVCEALLAIVDKREGLYGTSSSLEDDVVKVESCVLPRDRRLYHSLVLRVSERRILEKLRS
YVRERLGEGVSGGKRRKKMNSKS*

DNA
ATGGCCTCAAGGAGGTTAATTGCATTCAAGAAATGGATGAAAGCAAACGGAGTCGATTGCAGCGACGCTCTCGACCTCGT
CGAAGACCAAAACGACGCCGTATCCGTCAAAGCATCGCGCGACTTGAAGGAAGGAGACGTCGTTGCCAACATCTCCAAAA
CTGCTTGTCTCACCGTTAAAACCAGCGGGGCCCGTGAGATGATCGAATCCGCTGAGCTAGATGGACCTTTAGCTCTCTCA
GTGGCTATCATGTACGAGAGAGGCTTAGGCCAAGAGTCTCCATGGGCTGGTTACCTTCAGATCCTTCCTTTTCAAGAAGA
TTTGCCTCTTGTCTGGCCCCTTGATGAGTTGGACTCTCTCTTGTCTGGAACTGAGATTCACAAGGATGTGAAGAAAGACC
ACGGTCTTGTTTATGAGGATTGGGAAGAAAACATTGTGCCACTTACCCCTTTACTGCCTGAGAATGTTGATCCTGGTTCG
TTTGGAATCAAAGAGTATCTTGCGGCCAAGAGCCTAATTGCGTCACGGTCTTTCGAGATCGATGACTACCATGGATGGGG
GATGGTCCCTCTTGCAGATCTCTTCAATCATAAAACCGGGGAGGAAGATGTTCATTTCACCGCTGAGTTACCTCACAGTG
AATCTGATTCAGAAGCTGATGAAACTGACAACAGTGATGCTGCTAGTGCAGCCACTGATGAAGAAGACGAGACGTCCAGT
AAAAACTCTACCTCCCCTGAGCAATCTCTGGAGGATGAAAACACTGACGAAGAAGCCAAAGAAGAAGAAGACTCTTCCAT
GTTGCAAGACGATGTATCCAGTTTAGAAATGATCATGGTGAAGAACGTCCCAGCAGGAGCCGAGGTATACAACACATACG
GTTTGATAGGTAACGCTGCGTTACTCCACAGATACGGATTCACAGAACTCGACAATCTCTACAACATTGTAAACATAGAT
CTCGACCTAGTAACCGAGTGGAGCACATCCTCATTCACAACCCGGTACACTCGAGCCAGACTCGCCTTGTTTAAAAAGCT
AGGCTACAACTCAGAGTACTTCGAGGTCTCTTCAACCGGAGAACCCGAAACCGAGCTCCTGATGCTACTCAACATCCTCC
TCTTACCAGAAGACACATACAACAAACTCGACCTAGCGTTAACAGGAGATTGCGTCTCTAAGGAAGGAAGAGAGATAACA
ATCGGGAAACACAAGGTTAAGTTCGGAGAGAGTTGCAGCAGTGACGTGCTTCTCACGGATGGTGTGTGTGAGGCTCTTCT
TGCTATTGTGGATAAGAGAGAGGGTTTGTATGGGACGTCGAGCTCTTTGGAGGATGATGTTGTTAAGGTGGAGAGCTGTG
TTCTTCCGAGAGATAGGAGGTTGTATCATTCGCTTGTGTTGCGTGTGAGTGAGAGGAGGATTCTTGAGAAGCTTAGGAGC
TATGTTCGTGAGAGACTCGGTGAGGGGGTCTCCGGCGGGAAACGCCGGAAGAAGATGAACTCTAAATCTTAG