Details for Kale Locus Bo8g090890

Position : C8 ( 5`- 30576031 .. 30577329 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo8g090890

Protein [Map View]
MQSEESHELANEVSTKEESKETMKKSQKADRKKKKLKEKLLKEATKAVNRGVCYLSRIPPHMDHVRLRQILSQFGEIDRI
YLAPEDPEAQVHRKKAGGFRGQLFSEGWVEFAKKSIAKRVADMLNGEQIGGKKKSAIYYDIWNIKYLTKFKWDDLTDEIA
YKSAIREQKLNMVMSAAKREKDFYLSKVEKSRAMTEIDERMKKKRKIQEESGSNAEPAQVFPPRVVRQFRQKTAIKNEVS
QSKPGLSTDVLASVFGGS*

DNA
ATGCAGAGCGAGGAATCTCACGAGCTTGCGAATGAAGTATCCACCAAGGAGGAGAGTAAGGAAACAATGAAGAAGAGTCA
AAAGGCCGATAGAAAGAAAAAGAAGCTGAAAGAGAAGCTGCTCAAGGAAGCTACTAAGGCTGTCAATCGAGGAGTCTGCT
ACTTGAGCCGCATCCCGCCGCACATGGATCACGTTAGACTTCGCCAGATCCTCTCTCAGTTTGGTGAAATTGATAGGATT
TATCTTGCACCTGAAGATCCTGAAGCACAAGTTCACCGTAAGAAGGCTGGTGGATTTCGTGGCCAACTGTTTTCTGAAGG
GTGGGTTGAGTTTGCTAAGAAAAGCATTGCTAAGAGAGTCGCAGATATGCTTAATGGAGAACAAATAGGGGGAAAGAAGA
AGTCAGCTATATACTATGATATCTGGAACATCAAGTACTTGACCAAATTCAAATGGGACGATCTCACCGATGAAATTGCA
TACAAAAGTGCAATAAGGGAACAGAAACTGAATATGGTTATGTCTGCTGCTAAGAGAGAGAAGGACTTTTATCTCTCTAA
AGTAGAGAAGTCTCGTGCCATGACCGAGATCGATGAACGAATGAAGAAGAAGCGAAAGATTCAAGAAGAATCAGGCAGCA
ACGCTGAACCAGCACAAGTCTTCCCGCCTAGGGTGGTTCGTCAGTTTAGACAGAAGACAGCAATCAAAAATGAGGTGTCT
CAGAGCAAACCTGGACTCTCAACAGATGTCCTAGCATCGGTTTTCGGCGGTTCTTAA