Details for Kale Locus Bo8g090880

Position : C8 ( 5`- 30574109 .. 30575220 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo8g090880

Protein [Map View]
MASEKEAALSATPSDAPTIFDKIISKEIPSTVVYEDDKVLAFRDITPQGPVHILLIPKVRDGLTGLSKAEERHIDILGRL
LYTAKLVAKQEGLDDGFRIVINDGPQGCQSVYHIHVHLIGGRQMNWPPG*

DNA
ATGGCTTCCGAGAAAGAGGCTGCTCTATCCGCCACTCCTTCCGACGCTCCGACCATATTTGACAAGATCATCAGTAAGGA
GATTCCATCTACCGTGGTTTATGAGGATGACAAGGTTTTAGCTTTTAGGGACATAACGCCCCAGGGTCCTGTTCACATAC
TCCTCATCCCAAAAGTGAGAGATGGCTTAACTGGCCTCTCTAAGGCTGAGGAGAGGCACATTGACATCTTGGGCCGCCTT
CTCTACACTGCCAAGCTTGTAGCAAAACAAGAAGGCCTAGATGATGGTTTCAGAATTGTGATCAATGATGGTCCACAAGG
CTGCCAATCGGTGTATCACATTCATGTTCATCTCATTGGAGGACGCCAAATGAACTGGCCTCCTGGCTAA