Details for Kale Locus Bo8g090870

Position : C8 ( 5`- 30568466 .. 30570876 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo8g090870

Protein [Map View]
MTKVCPEIEDMTLPEPVTTVSADVSFASNHFPTYKLGPDNQIVEEPKEDEKGPSVQDTVEKESELLSDQHKRLSVRDLAS
KFDKNLAAAVTLADEAKLKEVASLEGHVMLKKLRDALEYMRGRMDGQNKEDVEKAISMVEALAVKLTQNEGELIQEKFEV
KKFGNFLKQASEDAKKLVNQEKSFACAEIESARAVVLKLGEAFEEQERSSEASRAQGPDVEKLVVEVQEARQIKRMHHPT
KVMGMQHELHGLRNRLQEKYMNSIKLHQEIKRAEESKSCPFVLEGTQSLGSCLRICVSSDNATDLSSCSIQWYRAACETS
RREAISDANQSVYAPEPFDVGRILQADILSNGQKVTVTTDGPIDPDSCLQSRVESLMRKSNSEFNVVISQMNGQDYASRT
HVFTVGKTRIKLSRGWITKAREIYSTSMQLCGVRGNIKAPAKALFWQPRKSLTFILTFESEQERNTAIVLARKYAFDCNV
TLLGPDD*

DNA
ATGACGAAAGTGTGTCCTGAGATCGAAGACATGACATTGCCAGAACCAGTTACTACAGTATCAGCGGATGTGAGCTTCGC
TTCTAATCATTTTCCAACCTACAAACTAGGACCTGATAATCAGATAGTAGAGGAACCAAAAGAAGATGAGAAAGGTCCAT
CAGTTCAAGACACTGTCGAGAAAGAGAGCGAGTTGTTGTCTGATCAGCACAAGCGTCTCTCAGTGCGTGACCTCGCTAGT
AAATTTGACAAGAACTTGGCTGCAGCTGTTACTTTGGCTGATGAGGCGAAATTAAAAGAGGTGGCTTCTTTAGAGGGACA
TGTTATGTTGAAGAAGCTAAGAGATGCTTTAGAGTACATGAGAGGACGCATGGACGGTCAAAACAAGGAGGATGTGGAGA
AAGCTATCTCTATGGTTGAAGCATTAGCTGTGAAGTTAACTCAGAATGAAGGTGAGCTAATTCAAGAAAAATTTGAAGTG
AAGAAATTTGGAAACTTCCTCAAGCAGGCTTCAGAAGATGCAAAGAAGCTGGTAAACCAAGAAAAATCATTTGCTTGTGC
TGAGATTGAAAGTGCCAGAGCCGTTGTGCTTAAACTTGGAGAGGCATTTGAAGAACAGGAGCGTAGTTCTGAAGCTTCTA
GAGCTCAGGGACCTGACGTTGAGAAACTGGTTGTGGAGGTCCAGGAAGCTAGACAGATCAAACGTATGCATCACCCAACA
AAGGTGATGGGCATGCAACATGAGCTTCATGGTTTAAGAAATCGACTCCAAGAGAAGTATATGAACTCTATTAAACTTCA
TCAAGAGATCAAGAGAGCCGAGGAATCAAAGTCCTGTCCGTTTGTTCTGGAAGGCACACAGAGTCTCGGCTCTTGCTTAA
GAATCTGTGTCTCCTCAGACAATGCTACAGATCTTTCCAGCTGTTCAATCCAGTGGTACCGTGCAGCATGTGAAACAAGT
AGAAGGGAAGCTATATCTGATGCAAACCAATCAGTATACGCACCAGAACCATTTGATGTTGGGAGGATATTACAGGCAGA
CATTCTCTCAAACGGACAGAAAGTCACTGTTACAACAGATGGTCCAATTGATCCTGATTCTTGCTTGCAATCCCGCGTAG
AGTCTCTGATGCGAAAATCAAACAGTGAATTCAATGTGGTTATATCACAGATGAATGGACAAGACTATGCATCTAGAACT
CATGTCTTTACCGTTGGAAAGACAAGGATAAAGTTGTCTAGAGGATGGATCACAAAGGCGAGAGAAATATACTCAACATC
TATGCAGCTCTGTGGAGTTAGAGGCAACATCAAGGCTCCTGCAAAGGCATTGTTCTGGCAACCAAGAAAGAGTCTAACTT
TCATACTAACCTTTGAGTCAGAACAAGAACGTAACACAGCCATAGTCCTTGCCCGAAAATACGCTTTCGATTGCAATGTT
ACACTGCTTGGGCCAGATGACTAA