Details for Kale Locus Bo8g090840

Position : C8 ( 5`- 30558692 .. 30559399 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo8g090840

Protein [Map View]
MGNRCARTPSCRKLWSRICCCCSNINNTNGQARSKHGSKGMVYPVTRIEIWEEKVTEAKNNGKILVVNFNASWCVPCKKL
EPIFRELASRYPSMIFVTIDVEELAEFSNEWNVEATPTIVFLKDGRQMDKLVGAETSELQKKTAAAADL*

DNA
ATGGGAAATCGCTGTGCTAGAACTCCTTCTTGTAGAAAGTTATGGTCACGTATATGCTGCTGCTGCAGCAACATCAACAA
CACCAACGGTCAAGCCCGAAGCAAACATGGTTCCAAAGGAATGGTCTATCCTGTAACAAGAATCGAAATATGGGAAGAAA
AGGTCACAGAAGCTAAAAACAATGGCAAGATTCTTGTGGTGAATTTCAACGCTTCATGGTGTGTACCTTGTAAAAAATTA
GAACCAATATTCAGAGAACTTGCTTCTAGATACCCTTCAATGATATTTGTAACCATTGATGTCGAAGAGCTTGCTGAGTT
TAGTAATGAATGGAATGTGGAAGCTACACCAACTATAGTGTTCCTTAAAGATGGGAGACAAATGGATAAACTTGTTGGTG
CAGAAACATCAGAGCTTCAGAAGAAAACAGCTGCAGCTGCAGATCTCTAA