Details for Kale Locus Bo8g090820

Position : C8 ( 5`- 30532976 .. 30534523 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo8g090820

Protein [Map View]
PISLFLLISSHLPLSKKKKDLIIASFLSPLYLHTLLFPLIISPTPIEREKPSKNSLNFTKMDIANNNKAITLKARDQLVQ
GREVATELQQLLFQHGLGLDSADDLVAKILGSFNNSISALDSLEPVSSSSSLVTAVEGSQNASCDNDGKLEDSGDSRKRL
GPVKGKRGCYKRKKRSETWTVESTVLEDAFSWRKYGQKEILNAKFPRSYFRCTHKFTQGCKATKQVQKLEPESKMFNITY
IGNHTCNTKEVAPKIKPCVHHDEIIMHSEDSPSLTTTMKEEEENQHHGSSTESDLQLVWQEILVCEEEHLHHHHVAIYGC
GETSANGLDSTDLWSW*

DNA
CCCATCTCTCTCTTCCTTCTCATTTCCTCCCATCTTCCTCTCTCCAAAAAAAAAAAAGATCTCATCATTGCAAGTTTCTT
ATCTCCATTATATTTACACACACTTCTCTTCCCTTTAATCATATCACCCACACCAATAGAGAGAGAAAAACCCTCCAAAA
ACTCTCTCAATTTCACCAAAATGGATATTGCTAATAATAACAAAGCAATAACGCTAAAAGCTAGGGACCAACTCGTTCAA
GGCCGTGAGGTGGCCACTGAGCTTCAGCAACTCCTCTTTCAACATGGGTTGGGTCTTGACTCAGCGGATGATCTGGTGGC
TAAAATCTTGGGATCTTTCAATAACTCAATCTCTGCTCTTGATTCCTTAGAACCCGTCTCCTCCTCCTCCTCTCTTGTCA
CCGCCGTTGAAGGCTCTCAAAATGCTTCCTGCGACAACGACGGCAAGCTTGAGGATTCCGGTGATAGTCGGAAAAGACTT
GGACCCGTTAAGGGTAAAAGAGGATGCTACAAAAGAAAGAAAAGATCGGAGACGTGGACTGTAGAGTCGACCGTACTTGA
GGACGCATTTTCATGGAGGAAGTATGGACAAAAGGAGATTCTTAATGCCAAATTCCCAAGAAGTTACTTTCGGTGCACAC
ATAAATTCACACAAGGGTGCAAGGCAACAAAGCAAGTGCAGAAGCTAGAGCCCGAATCCAAGATGTTCAACATCACATAC
ATAGGAAACCACACGTGTAACACCAAAGAAGTAGCACCCAAGATCAAGCCTTGTGTTCATCATGATGAGATCATTATGCA
TTCTGAAGATAGTCCTAGTTTGACGACCACGATGAAGGAAGAGGAAGAGAATCAGCATCATGGTTCTTCCACTGAGAGTG
ACTTGCAATTAGTGTGGCAAGAAATATTGGTCTGTGAAGAAGAACATCTTCATCATCATCATGTCGCTATTTATGGGTGT
GGTGAAACTAGTGCCAATGGTTTGGATTCCACAGATCTTTGGAGTTGGTAG