Details for Kale Locus Bo8g090790

Position : C8 ( 5`- 30520980 .. 30521657 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo8g090790

Protein [Map View]
MASICCGGGRGGRARAVRSDRRTVTVRSPCVVPVINRRSWVETGKISMTMSMADMAPPVKIGERKRGGSVVSREKIEEWL
RASVVEIVKNLRESPLLVHLYAEANGGLSTTAKNPEAEDWKAMVGRWGRGEERTPEGVIFVEKLDDDEGDDHGGFNGGEG
ATSAWGIVAQGRGTDCGPVCYLLKTTRVGSGMGTVCTHFCLVKVKSFRETALSQLNNSWLVQTGQ*

DNA
ATGGCGAGTATTTGTTGCGGCGGAGGAAGAGGAGGACGCGCACGTGCCGTTCGTTCTGATCGGCGAACTGTCACCGTTCG
ATCTCCGTGTGTTGTTCCGGTGATTAATCGACGGAGTTGGGTAGAGACTGGGAAGATTTCGATGACGATGTCAATGGCTG
ATATGGCGCCGCCGGTGAAGATCGGCGAAAGGAAACGCGGCGGATCGGTTGTGTCGCGAGAAAAGATCGAGGAGTGGCTG
AGGGCTTCGGTTGTTGAGATCGTGAAGAATCTGAGAGAGTCGCCGTTGTTGGTGCACTTGTACGCGGAGGCGAACGGAGG
CTTGAGTACGACGGCGAAGAATCCGGAGGCGGAGGATTGGAAGGCGATGGTAGGAAGGTGGGGTAGAGGAGAGGAGAGGA
CGCCGGAGGGAGTGATCTTCGTGGAGAAGCTAGATGACGATGAAGGAGATGATCACGGTGGATTCAACGGTGGAGAAGGT
GCAACAAGCGCTTGGGGGATAGTGGCGCAGGGAAGAGGAACGGATTGTGGACCGGTTTGCTACCTGTTGAAAACGACCCG
GGTTGGGTCGGGTATGGGGACGGTTTGCACACATTTTTGCTTGGTGAAGGTGAAGAGTTTTAGGGAGACGGCTTTGTCAC
AGTTGAATAACTCCTGGTTGGTGCAGACTGGTCAATGA