Details for Kale Locus Bo8g090780

Position : C8 ( 5`- 30518102 .. 30519395 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo8g090780

Protein [Map View]
MSIVVSIILLTVFAMSIDVGTGKSTTMDPCLESMKTASLPDLPYAYDALEPAISEEIMRLHHQKHHQTYVTNYNKALEHL
RSALADGDHSSVVKLQSQIKFNGGGHVNHAIFWKNLAPVHEGGGKPPHDPLSSAIDAHFGSLEELMQKMNTEGAAVQGSG
WVWFGLDKELKRLVVETTANQDPLVTKGSHLVPLVGIDVWEHAYYPQYKNARAEYLKNIWTVINWKYASDIFVKHNRDLN
EF*

DNA
ATGAGCATCGTTGTTTCTATCATCCTCCTTACTGTTTTCGCTATGAGCATTGACGTTGGAACAGGAAAAAGTACCACCAT
GGACCCGTGTCTTGAGTCGATGAAGACCGCTTCACTTCCTGATCTTCCCTACGCTTACGATGCACTAGAGCCAGCGATCA
GCGAGGAGATCATGCGGTTGCACCACCAGAAACACCACCAGACTTACGTTACTAATTACAACAAAGCCCTCGAACATCTC
CGCTCCGCCTTGGCCGATGGTGATCACTCCTCCGTCGTCAAACTTCAGAGCCAAATCAAGTTCAACGGCGGAGGTCACGT
TAACCATGCAATCTTCTGGAAAAACCTAGCCCCTGTTCATGAAGGAGGTGGTAAGCCACCGCACGATCCTTTGTCTTCGG
CTATAGATGCTCATTTTGGCTCCTTAGAAGAATTAATGCAAAAGATGAACACCGAAGGTGCTGCTGTGCAGGGATCTGGA
TGGGTGTGGTTTGGACTAGACAAAGAGCTAAAGAGACTTGTCGTTGAGACCACAGCTAATCAGGATCCATTGGTGACTAA
AGGATCACACCTGGTTCCTCTTGTCGGAATAGACGTATGGGAGCACGCCTACTATCCACAGTACAAAAATGCAAGAGCAG
AGTACTTGAAGAACATATGGACTGTGATCAACTGGAAATACGCTTCGGACATATTCGTGAAGCACAACCGAGATCTAAAC
GAGTTTTAG