Details for Kale Locus Bo8g090720

Position : C8 ( 5`- 30496358 .. 30497214 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo8g090720

Protein [Map View]
MGLRALPLQHSGGFVATTKVPILRTLPIISQKPRWVVVSAKQEKDEEKKKEDETSLFTRLTDALDFAQVRSEKDAELLYE
AREATKSGGKMNKEQYGALRRKIGGTYKDFFKSYVEVDGEYVEEGWVDKTCKVCKKDTKGEARQVDKLGRYVHVSCLQNP
SKPSGNFFTRLFSR*

DNA
ATGGGTCTAAGAGCACTGCCTCTACAGCACAGCGGTGGGTTCGTCGCCACGACCAAAGTCCCGATCTTAAGAACCTTGCC
GATAATAAGCCAGAAACCTAGATGGGTCGTCGTGTCAGCAAAGCAAGAGAAAGATGAGGAGAAGAAGAAGGAAGACGAGA
CTTCGTTGTTCACTAGACTAACGGATGCGTTGGATTTCGCACAGGTTCGGTCGGAGAAAGACGCTGAGCTTCTCTATGAG
GCCCGTGAAGCCACCAAATCCGGTGGTAAGATGAACAAAGAACAGTATGGAGCATTGAGAAGAAAAATTGGAGGAACATA
CAAGGACTTTTTTAAATCCTATGTTGAAGTGGATGGAGAATATGTGGAGGAAGGATGGGTGGACAAAACATGTAAGGTAT
GCAAAAAGGACACAAAGGGTGAGGCGAGACAAGTGGACAAGTTAGGGAGATATGTTCATGTCTCCTGCCTACAAAATCCC
TCAAAACCTTCTGGAAATTTCTTCACCAGACTCTTCTCTAGGTGA