Details for Kale Locus Bo8g090700

Position : C8 ( 5`- 30488487 .. 30490225 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo8g090700

Protein [Map View]
MAERRLQKNPAAEAIPGTPRIRDVRIVSGSEVTGLCSRGPSRVPFKLKDNYDGVGEFDLKKMEENAAKLEKDLIMKELET
LDFLEALGSTKKIVKDFKLELQQQQPMRCMESPEHLHSQIKEMNHDERCHRSSPMRSPDMIFMELKQANMNLGKTMEDLS
MIRSYVKSLNMKTVEHKDFLGVASLAEELNSLRLKHDDEERFITKNVSVNPQCEQVKMVVETNDNKHSNACLKTAKMRLV
AARKMEETARAAEALAIAEMAILSSKKDQEEFCFPEPPRSPLTLKEQMQEDISIEIMRKLEEANEEVKQSQRALENALNR
VEIANVKQLEAEDAVRQWNIESWKDQKAIRAKRPMRDDNIPRRSFLSHVSQHEPVDNLPKPMLKRNVSVGSGLNRKQVPN
IDEKHLRRKFRFMHNTVPEQIE*

DNA
ATGGCTGAGAGGAGGCTTCAAAAGAACCCTGCGGCGGAGGCTATTCCCGGTACACCGAGAATCCGGGATGTGAGAATCGT
ATCCGGGTCGGAGGTAACCGGATTATGTAGTCGTGGGCCTTCTCGGGTTCCATTCAAACTCAAAGACAATTACGACGGTG
TGGGAGAATTTGACCTAAAGAAAATGGAAGAAAATGCAGCAAAGCTTGAGAAGGATCTGATCATGAAAGAGTTAGAAACT
CTAGATTTTCTAGAAGCTCTTGGATCAACAAAAAAGATCGTAAAAGACTTCAAGCTGGAGCTGCAGCAGCAACAACCCAT
GAGATGCATGGAGAGCCCTGAACATCTCCATTCACAAATCAAAGAGATGAACCATGATGAACGTTGCCATCGTAGTAGTC
CCATGAGGTCTCCAGATATGATCTTCATGGAACTGAAGCAAGCCAATATGAATCTTGGTAAAACCATGGAAGATCTTTCA
ATGATCCGATCCTACGTTAAATCTTTGAATATGAAGACGGTGGAACATAAAGATTTTCTTGGAGTGGCGTCTCTAGCTGA
GGAGCTCAACAGTTTGAGGTTAAAACATGATGATGAAGAGAGATTCATTACCAAGAATGTATCCGTGAACCCGCAATGCG
AACAAGTTAAGATGGTTGTTGAAACCAATGATAACAAACATAGCAATGCATGTCTGAAAACCGCAAAAATGAGATTGGTT
GCTGCAAGAAAAATGGAGGAAACTGCTAGAGCAGCGGAAGCACTTGCCATTGCTGAAATGGCCATACTATCCAGCAAGAA
AGACCAAGAAGAGTTTTGCTTTCCAGAGCCACCGAGGTCACCTTTAACACTCAAAGAACAAATGCAAGAAGACATATCCA
TTGAGATCATGAGGAAGCTGGAGGAAGCTAATGAAGAAGTTAAACAAAGCCAACGAGCCTTAGAAAATGCGTTAAACAGA
GTAGAAATCGCTAACGTGAAGCAGCTTGAAGCAGAAGATGCGGTTCGCCAGTGGAACATTGAGTCATGGAAAGATCAGAA
AGCTATTAGAGCAAAGCGGCCCATGAGAGATGATAACATTCCTCGACGCTCCTTCTTGAGCCATGTGAGCCAGCACGAGC
CGGTTGATAATCTCCCTAAGCCGATGCTAAAACGTAATGTTTCAGTCGGCAGTGGCCTAAACCGGAAACAAGTCCCTAAC
ATTGATGAGAAACATTTGAGGAGAAAGTTTAGATTCATGCACAACACGGTTCCTGAACAAATAGAGTAA